KEGG   Burkholderia pseudomallei 668: BURPS668_3308
Entry
BURPS668_3308     CDS       T00481                                 

Gene name
phnJ
Definition
(GenBank) phosphonate metabolism protein PhnJ
  KO
K06163  alpha-D-ribose 1-methylphosphonate 5-phosphate C-P lyase [EC:4.7.1.1]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00440  Phosphonate and phosphinate metabolism
bpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BURPS668_3308 (phnJ)
Enzymes [BR:bpd01000]
 4. Lyases
  4.7  carbon-phosphorus lyases
   4.7.1  carbon-phosphorus lyases (only sub-subclass identified to date)
    4.7.1.1  alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase
     BURPS668_3308 (phnJ)
SSDB
Motif
Pfam: PhnJ
Other DBs
NCBI-ProteinID: ABN83604
UniProt: A3ND98
LinkDB
Position
I:complement(3248909..3249883)
AA seq 324 aa
MNAPDHCAAAAPDTHAAEGYNFAYLDEQTKRMIRRALLKAVAVPGYQVPFASREMPLPFG
WGTGGIQVTAALIGRDDTLKVIDQGSDETTNAVNIRRFFARTAGVATTTKTAQATIIQTR
HRVPETPLTERQILVYQVPMPEPLFRLEPRATECAKLHAHADYGLMRVKLYEDIVHHGSI
ATTYDYPVIVNGRYLSSPSPIPKFDNPKLHMNPALQLFGAGRERRIYAIAPYTPVASLDF
DDHPFEVQRWDAACALCGSRESFLDEMIVDDHGTRRFVCSDSDYCSDRRGGAQARADGGD
EGNGGGDGEMPAPLAAEQPLGETT
NT seq 975 nt   +upstreamnt  +downstreamnt
atgaacgcgcccgaccattgcgcggccgccgcgcccgacacgcacgccgccgaaggctac
aacttcgcgtacctcgacgagcagacgaagcggatgatccgccgcgcgctgctcaaggcg
gtcgcggtgccgggctatcaggtgccgttcgcgtcgcgcgagatgccgctgccgttcggc
tggggaacgggcggcattcaggtgacggccgcgctgatcggccgcgacgatacgctgaag
gtgatcgatcagggctccgacgaaacgacgaacgcggtcaacatccgtcgcttcttcgcg
cgcaccgcgggcgtcgcgacgacgacgaagacggcgcaagcgacgatcatccagacgcgc
caccgcgttccggagacgccgctcaccgagcgtcagatcctcgtctatcaggtgccgatg
ccggagccgctctttcgcctggagccgcgcgcgaccgaatgcgcgaagctgcacgcgcac
gccgattacgggctgatgcgcgtgaagctgtacgaggacatcgtgcatcacggcagcatc
gcgacgacgtacgattacccggtgatcgtcaacggccgctacctgagctcgccgtcgccg
atcccgaagttcgacaatccgaagctgcacatgaacccggcgctgcaactgttcggcgcg
gggcgcgagcgccgcatctacgcgattgcgccgtacacgccggtcgcgagcctcgatttc
gacgatcatccgttcgaagtccagcgctgggacgccgcgtgcgcgctgtgcggctcgcgc
gagagctttctcgacgagatgatcgtcgacgatcacggcacgcgccgcttcgtgtgctcg
gacagcgactattgcagcgaccgccgcggcggcgcgcaggcgcgcgccgacggcggcgac
gagggcaacggcggcggcgacggggagatgcccgcgccgctcgcggccgaacagccgctg
ggagagacgacatga

DBGET integrated database retrieval system