KEGG   Burkholderia pseudomallei 668: BURPS668_3309
Entry
BURPS668_3309     CDS       T00481                                 

Gene name
phnI
Definition
(GenBank) phosphonate metabolism protein PhnI
  KO
K06164  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI [EC:2.7.8.37]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00440  Phosphonate and phosphinate metabolism
bpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BURPS668_3309 (phnI)
Enzymes [BR:bpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     BURPS668_3309 (phnI)
SSDB
Motif
Pfam: PhnI PhnG
Other DBs
NCBI-ProteinID: ABN85033
UniProt: A3ND99
LinkDB
Position
I:complement(3249880..3251082)
AA seq 400 aa
MLMYVAVKGGERAIEASWRLLDQARRGDPAVPELSVEQIREQQRLAVARVMTEGSLYDEA
LAALAIKQAAGDLVEAIFLLRAYRTTLPRFGYTAPIDTGAMRLERRISATFKDIPGGQLL
GPTYDYTQRLLDFALLAEGGAARHEPHEAESARAAADAGSPPPHATHAPPPAAARVIALL
NDEGLIEEERPTAVGAEPGDLSREPLAFPADRATRLQNLARGDEGFLLAMGYATQRGYGH
SHPFAGELRFGAVAVEMALDELDGETIEIGELDVTECQMINHFSGGDGEPPRFTQGYGLA
FGHSERKAIAMALVDRALRASELGEAAHSPPQDQEFVLSHSDNVEASGFVQHLKLPHYVD
FQSELELVRRLRAGHAAQAGAGANAPARAERADTHTEESR
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctgatgtacgtggcagtcaagggcggcgagcgggcgatcgaggcgtcgtggcgtttg
ctcgaccaagcgcggcgcggcgaccccgccgtgcccgagctgagcgtcgagcagattcgc
gagcagcagcgcctcgcggtcgcgcgcgtgatgacggaaggctcgctgtacgacgaggcg
ctggcggcgctcgcgatcaagcaggcggcgggcgatctcgtcgaggcgatcttcctgctg
cgcgcataccggacgacgctgccgcgcttcggctacaccgcgccgatcgataccggcgcg
atgcggctcgagcgacggatctcggcaacgttcaaggacatcccgggcggccagttgctc
ggcccgacctacgattacacgcagcggctgctcgatttcgcgctgctcgccgaaggcggc
gcagcgcggcacgagccgcacgaggccgaatcggcgcgcgccgcggccgacgcaggctcg
ccgccgccgcatgcgacgcatgcgccgccgcccgcggctgcgcgcgtgatcgcgctcctg
aacgacgaaggcctgatcgaagaggagcggccgacggcggtcggcgccgagccgggcgac
ctgtcgcgcgagccgctcgcgtttccggccgatcgcgcgacgcgcctgcagaatctcgca
cgcggcgacgaaggttttctgctcgcgatgggctacgcgacgcagcgcggctacggtcat
tcgcatccgttcgcgggcgagctgcgctttggcgccgtcgccgtcgaaatggcgctcgac
gagctcgacggcgagacgatcgagatcggtgagctcgacgtgaccgagtgccagatgatc
aaccatttttccggcggcgacggcgagccgcctcgcttcacgcagggctacggcctcgcg
ttcggccattcggagcgcaaggcgatcgcgatggcgctcgtcgatcgcgcgctgcgcgcg
tccgagctcggcgaagccgcgcactcgccgccgcaggatcaggagttcgtgctgtcgcac
agcgacaacgtcgaggcgtccggcttcgtccagcacctgaagctgccgcactacgtcgat
ttccagtccgagctcgagctcgtgcgccgcctgcgcgccgggcatgcggcgcaggcggga
gcgggcgcgaacgcgcccgcccgcgccgaacgcgccgacacgcacaccgaggagtcccga
tga

DBGET integrated database retrieval system