KEGG   Burkholderia pseudomallei 668: BURPS668_3310
Entry
BURPS668_3310     CDS       T00481                                 

Gene name
phnH
Definition
(GenBank) phosphonate C-P lyase system protein PhnH
  KO
K06165  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH [EC:2.7.8.37]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00440  Phosphonate and phosphinate metabolism
bpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BURPS668_3310 (phnH)
Enzymes [BR:bpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     BURPS668_3310 (phnH)
SSDB
Motif
Pfam: PhnH
Other DBs
NCBI-ProteinID: ABN83854
UniProt: A3NDA0
LinkDB
Position
I:complement(3251076..3251705)
AA seq 209 aa
MTMIDTRFSLADVAPGFADPVQATQRVFRTLLDAMARPGTPGRIEPIGANGSDAAPAMRV
APAAFASLLTLCDASTPVFLGAPDAALASALRFHTGAPIAAEPRAACFAYLDDANALPPL
QCFASGAPQTPEHAVTLFVRVASLADGEPRTLRGPGIRDARTIAPAGLPDAFWRERAQFA
PRFPCGIDCYLVCGDMLIGLPRTTIVEAC
NT seq 630 nt   +upstreamnt  +downstreamnt
atgacgatgatcgatacgcgtttctcgctcgccgatgtcgcgcccggcttcgcggatccg
gtgcaagccacgcagcgcgtgttccgcacgctgctcgacgcgatggcgcgccccggcacg
cccgggcgcatcgagccgatcggcgcgaacggctcggacgccgcgccggcgatgcgcgtc
gcgcccgcggcgttcgcgtcgctgctcacgctgtgcgacgcgtccacgccggtgtttctc
ggcgcgccggacgcggcgctcgcgtcggcgctgcgcttccatacgggcgcgccgatcgcc
gccgagccgcgcgccgcgtgcttcgcctacctcgacgacgcgaacgcgctgccgccgctg
cagtgcttcgcgagcggcgcgccgcagacgcccgagcatgcggtgacgctgttcgtgcgc
gtcgcgtcgctcgcggacggcgagccgcgcacgctgcgcgggccgggcattcgcgacgcg
cgcacgatcgcgccggcgggcttgcccgatgcattctggcgcgagcgcgcgcaattcgcc
ccgcgctttccgtgcggaatcgattgctacctggtgtgcggcgacatgctgatcggcctg
ccgcgcacgacgatcgtggaggcatgctga

DBGET integrated database retrieval system