KEGG   Burkholderia pseudomallei 668: BURPS668_3311
Entry
BURPS668_3311     CDS       T00481                                 

Gene name
phnG
Definition
(GenBank) phosphonate C-P lyase system protein PhnG
  KO
K06166  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG [EC:2.7.8.37]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00440  Phosphonate and phosphinate metabolism
bpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BURPS668_3311 (phnG)
Enzymes [BR:bpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     BURPS668_3311 (phnG)
SSDB
Motif
Pfam: PhnG Collagen TetR_C_11
Other DBs
NCBI-ProteinID: ABN84982
UniProt: A3NDA1
LinkDB
Position
I:complement(3251702..3252286)
AA seq 194 aa
MSASAVSSLHAARRDWLAVLAKIPRDELERALDRVLDGAPAPAFDWLRAPEIGLAMVRGR
IGGTGDPFNLGEASVTRAALRLRGDARDRTNGATGATGTNGTNGTTGADGMNGANGANRP
HGATVGIAYVLGRDKRRAELVALADALLQTPERHERLRAALIEPFRARLAQARAARSGEI
ATTRVEFFTMVRGE
NT seq 585 nt   +upstreamnt  +downstreamnt
atgagcgcctcagccgtttcctccttgcatgccgcgcgacgcgactggctcgcggtgctg
gcgaagattccccgcgacgaactcgagcgggcgctcgatcgcgtgctcgacggcgcgccc
gcgcccgcgttcgactggctgcgcgccccggagatcgggctggcgatggtgcgcgggcgc
atcggcggcacgggcgatccgttcaatctcggcgaggcgagcgtcacgcgcgccgcgctg
cgcctgcgcggcgacgcgcgcgaccgcacgaacggcgcgaccggcgcgaccggcacgaac
ggcacgaacggcacgaccggcgcggatgggatgaatggtgcgaacggtgcgaaccgcccg
cacggcgcgacggtcggcatcgcttacgtgctcggccgcgacaagcggcgcgcggagctc
gtcgcgctcgccgacgcgctattgcagacgccggagcgccatgagcggctgcgcgccgcg
ctgatcgagccgtttcgcgcacgccttgcgcaagcgcgtgcggcgcgctcgggggaaatc
gcgacgacgcgcgtcgaattcttcacgatggtgcgaggcgaatga

DBGET integrated database retrieval system