KEGG   Burkholderia pseudomallei 668: BURPS668_3876
Entry
BURPS668_3876     CDS       T00481                                 

Definition
(GenBank) putative acyl carrier protein
  KO
K02078  acyl carrier protein
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00998  Biosynthesis of various secondary metabolites - part 2
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BURPS668_3876
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BURPS668_3876
SSDB
Motif
Pfam: PP-binding_2 PP-binding
Other DBs
NCBI-ProteinID: ABN82722
UniProt: A3NEU9
LinkDB
Position
I:3779547..3779768
AA seq 73 aa
MNAFYEGLAEIFEIDASEVTPALALGEHNWDSLAIVSTIALADDCFGVLLNGQALGNCKT
VADIDALVAAQKG
NT seq 222 nt   +upstreamnt  +downstreamnt
atgaacgcattctacgaaggcctcgcggaaatcttcgagatcgacgcgagcgaagtcacg
cccgcgctcgcgctcggcgagcacaactgggattcgcttgcgatcgtgtcgacgatcgcg
ctcgccgacgactgcttcggcgtgctgctcaacggccaggcgctcggcaactgcaagacg
gtcgccgatatcgacgcgctcgtcgcggcgcaaaagggctga

DBGET integrated database retrieval system