KEGG   Burkholderia pseudomallei 668: BURPS668_3936Help
Entry
BURPS668_3936     CDS       T00481                                 

Gene name
eutE
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00010  Glycolysis / Gluconeogenesis
bpd00620  Pyruvate metabolism
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
bpd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS668_3936 (eutE)
   00620 Pyruvate metabolism
    BURPS668_3936 (eutE)
Enzymes [BR:bpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BURPS668_3936 (eutE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABN84323
UniProt: A3NF08
LinkDB All DBs
Position
I:3836179..3837891
Genome map
AA seq 570 aa AA seqDB search
MPHLNNRRATSVQQWRSPPRRARAEPRAGAPMHRGAACWHGFGVTNGVAHVARRITDTDM
RGATMNHADMQHLNIEFPYRKQYGNFIGGEWVAPVGGEYFDNVSPVTGRPFTAIPRSREA
DIELALDAAHAAKAGWAAKGAAERANVLLRIADRMEANLTRLAVAETIDNGKPLRETTAA
DVPLAIDHFRYFAGCIRAQEGSIADIGGDMVAYHFHEPLGVVGQIIPWNFPLLMAAWKLA
PALAAGNCVVLKPAEQTPASILVFAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKI
AFTGETSTGRLIMQYASENLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALN
QGEVCTCPSRALVEESIYDRFIERALKRVEAIKQGHPLDSQTMIGAQASAEQLEKILSYI
DIGRGEGAQCLTGGERNVLGGELAEGYYVKPTVFRGHNKMRIFQEEIFGPVLAVTTFKTE
EEALEIANDTLYGLGAGVWTRDGNRAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGI
GRETHKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcatttgaacaaccggcgcgcgacgagtgttcagcaatggcgcagtccgccgcgc
cgagcgcgcgccgagccccgcgccggcgccccgatgcaccgcggcgcggcgtgctggcac
ggttttggcgtaacgaacggcgtcgcgcacgtcgcgcggcgcatcaccgataccgacatg
cgaggagcaacgatgaatcacgcggacatgcaacatctgaacatcgaattcccgtaccgc
aagcagtacgggaatttcatcggcggcgaatgggtcgccccggtcggcggcgagtatttc
gacaacgtctcgcccgtcaccggccggccgttcaccgcgatccctcgctcgcgcgaagcc
gacatcgagctcgcgctcgacgccgctcacgcggccaaggcgggctgggccgcgaagggc
gcggccgagcgcgcgaacgtgctgctgaggatcgccgaccggatggaggcgaacctcacg
cgcctcgccgtcgccgagacgatcgacaacggcaagccgctgcgcgaaaccaccgcggcc
gacgtgccgctcgcgatcgaccacttccgctacttcgcgggctgcatccgcgcgcaggaa
ggctcgatcgccgatatcggcggcgacatggtggcctaccacttccacgagccgctcggc
gtcgtcggccagatcatcccgtggaacttcccgctgctgatggccgcgtggaagctcgcg
ccggcgctcgcggccggcaactgcgtcgtgctcaagccggccgagcagacgcccgcgtcg
atcctcgtgttcgccgagctgatccaggatctgctgccgcccggcgtgctcaacatcgtc
aacggcttcggcctcgaggccggcaagccgctcgcgtcgagcaagcggatcgcgaagatc
gcgttcacgggcgagacgtcgacgggccgcctcatcatgcagtacgcgagcgagaacctg
attcccgtcacgctcgagctgggcggcaagagcccgaatattttcttcgccgacgtgatg
gatcgcgacgacagctacttcgacaaggcgctcgaaggcttcgcgatgttcgcgctgaac
cagggcgaagtctgcacgtgcccatcgcgcgcgctcgtcgaggagagcatctacgatcgc
ttcatcgaacgcgcgctcaagcgcgtcgaggcgatcaagcagggccatccgctcgattcg
cagacgatgatcggcgcgcaggcgtcggccgagcagctcgagaagatcctgtcgtacatc
gacatcggccgcggcgaaggcgcgcaatgcctgacgggcggcgagcgcaacgtgctcggc
ggcgagctcgccgaaggctattacgtgaagccgaccgtgttccgcggccacaacaagatg
cgcatcttccaggaagaaatcttcgggccggtgctcgcggtgacgacgttcaagaccgag
gaggaagcgctcgagatcgcgaacgacacgctgtacggcctgggcgccggcgtctggacg
cgcgacggcaaccgcgcgtaccgcttcggccgcggcatccaggcgggccgcgtgtggacg
aactgctatcacgcgtatccggcgcacgcggcgttcggcggctacaagcaatccggcatc
ggccgcgagacgcacaagatgatgctcgaccactaccagcagacgaagaacctgctcgtc
agctacagcgaaaagccgctcgggttcttctga

DBGET integrated database retrieval system