KEGG   Burkholderia pseudomallei 668: BURPS668_A0494Help
Entry
BURPS668_A0494    CDS       T00481                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00250  Alanine, aspartate and glutamate metabolism
bpd00410  beta-Alanine metabolism
bpd00640  Propanoate metabolism
bpd00650  Butanoate metabolism
bpd01100  Metabolic pathways
bpd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BURPS668_A0494 (gabT)
   00650 Butanoate metabolism
    BURPS668_A0494 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BURPS668_A0494 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BURPS668_A0494 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpd01007]
    BURPS668_A0494 (gabT)
Enzymes [BR:bpd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BURPS668_A0494 (gabT)
Amino acid related enzymes [BR:bpd01007]
 Aminotransferase (transaminase)
  Class III
   BURPS668_A0494 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABN87443
UniProt: A3NGM9
LinkDB All DBs
Position
II:complement(448706..449989)
Genome map
AA seq 427 aa AA seqDB search
MNNADLHARKNAATPRGVGVMCDFYASRAENAELWDVEGRRFIDFAAGIAVLNTGHRHPR
IVKAIADQLGQFTHTAYQIVPYASYVELAEKINARAPIAQPKKTAFFTTGAEAVENAVKI
ARAYTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKIGFGPFPGDVFHAPYPNALHGVTSA
DSIAAVETLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKLCDAHGILLIADEV
QTGFARTGKLFAMEHYDVSADLMTIAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDVIDEEKLAERATVLGDKLKAKLAALRAELPQIVDVRGPGAMVAAEFVD
PHTRASDAAFTKRVQTLALERGLLLLICGVDANVIRFLFPLTIEDAVFDEALGILESVLR
EAVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatgccgatctgcacgcccgcaagaacgccgcgacgccgcgtggcgtcggcgtg
atgtgcgatttctacgcgtcgcgcgccgagaacgccgagctgtgggatgtcgagggccgc
cgcttcatcgatttcgcggccggcatcgcggtcctgaacacgggccatcgccatccgagg
atcgtgaaggcgatcgccgaccagctcgggcaattcacgcataccgcgtatcagatcgtg
ccgtacgcgtcgtacgtcgagctcgccgagaagatcaacgcgcgcgcgccgatcgcgcag
ccgaagaagaccgcgttcttcacgacgggcgcggaagcggtcgagaacgcggtgaagatc
gcgcgcgcctacaccggccggccgggcgtgatcgcgttcgcgggcggcttccacggccgc
acgatgatgggcatggcgctcaccggcaaggtcgcgccgtacaagatcggcttcggcccg
ttcccgggcgacgtgttccacgcgccgtacccgaacgcgttgcacggcgtgacgagcgcc
gattcgatcgcggccgtcgaaacgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgagccggtgcagggcgaaggcggcttcaacccggcgcccgccgagttc
gtgcgcgcgctgcgcaagctgtgcgacgcgcacggcattctcctcatcgccgacgaagtg
cagacgggcttcgcgcgcacgggcaagctgttcgcgatggagcactacgacgtctcggcc
gacctgatgacgatcgcgaagagcctcgcgggcgggatgccgctgtcgggcgtcgtcggc
cgcgcggacgtgatggacgcggccgcgccgggtggcctgggcggcacatacgcgggcaat
ccgctcgccgtggccgccgcgcacgcggtgctcgacgtgatcgacgaggagaagctcgcc
gagcgcgcgaccgtgctcggcgacaagctgaaggcgaagctcgccgcgctgcgcgccgag
ctgccgcagatcgtcgacgtgcgcggcccgggcgcgatggtcgccgcggaattcgtcgat
ccgcacacgcgcgcgtccgatgccgcgttcacgaagcgcgtgcagacgctcgcgctcgag
cgcgggctgctgctgctcatctgcggcgtcgacgcgaacgtgatacgtttcctgtttcct
ctcaccatcgaggatgccgtgttcgacgaagcgctcggcattctcgagagcgtgctgagg
gaagcggtgggcgtgcccgcctga

DBGET integrated database retrieval system