KEGG   Burkholderia pseudomallei 668: BURPS668_A0582
Entry
BURPS668_A0582    CDS       T00481                                 

Gene name
phnW
Definition
(GenBank) 2-aminoethylphosphonate--pyruvate transaminase
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00440  Phosphonate and phosphinate metabolism
bpd01100  Metabolic pathways
bpd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BURPS668_A0582 (phnW)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpd01007]
    BURPS668_A0582 (phnW)
Enzymes [BR:bpd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     BURPS668_A0582 (phnW)
Amino acid related enzymes [BR:bpd01007]
 Aminotransferase (transaminase)
  Class V
   BURPS668_A0582 (phnW)
SSDB
Motif
Pfam: Aminotran_5 Aminotran_1_2
Other DBs
NCBI-ProteinID: ABN87994
UniProt: A3NGW6
LinkDB
Position
II:complement(549117..550226)
AA seq 369 aa
MPERDPILLTPGPLTTSRMTRDAMLRDWGSWDAAFNRLTKSVCADLVRIAGGGDAYVCVP
LQGSGTFAVEATLGTLVPRDARVLVPNNGAYCARIAAILRRLGVAHVELPFAEDEPASAH
AIDAALARDARLTHVALVHLETSAGLLNPLDDIAAVCRARGKALIVDAMSSFGALPIALA
ASGIDALISASGKCLEGVPGMGFAIVRRSALEAAEGRSPSVALDLHDQYAYMQRTSQWRF
TPPTHVLAALRAALDQFFDEGGQPARGARYARNCATLVDGMRALGFEPFLDARAQASVIV
TFYAPADPAYAFPAFYAAVRDAGYVLYPGKLTTADTFRVGCIGALGADEMRGAVAAIGGA
LESLGIAMR
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgccagaacgtgatcccatcctgttgacgcccggcccgctgacgacctcgcgcatgacg
cgcgacgcgatgctgcgcgactggggctcgtgggacgccgctttcaaccggctgacgaag
agcgtctgcgcggatctcgtgcggatcgcgggcggcggcgacgcatatgtgtgcgtgccg
ctgcaaggcagcggcacgtttgcggtcgaagcgacgctcggcacgctcgtgccgcgcgac
gcccgcgtgctcgtgccgaacaatggcgcgtactgcgcgcggatcgcggcgatcctgcgc
cggctcggcgtcgcgcacgtcgagctgccgttcgccgaggacgagccggcgagcgcgcac
gcgatcgacgcggcgctcgcgcgcgacgcgcgcctcacgcacgtcgcgctcgtgcatctg
gagacgagcgccggcctgctgaacccgctcgacgacatcgccgccgtctgccgcgcgcgc
ggcaaggcgctgatcgtcgatgcgatgagctcgttcggtgcgctgccgatcgcgctcgcg
gcaagcggcatcgacgcgctgatctcggcgagcggcaagtgcctggaaggagtgcccggc
atgggcttcgcgatcgtgcggcgttcggcgctcgaagcggccgaggggcgctcgccttcg
gtcgcgctcgatctgcacgaccagtacgcatacatgcagcgcacgtcgcaatggcgcttc
acgccgccgacgcacgtgctcgccgcgctgcgcgccgcgctcgaccagttcttcgacgaa
ggcgggcagccggcgcgcggcgcgcgctacgcgcggaactgcgcgacgctcgtcgacggc
atgcgcgcgctcggcttcgagccgtttctcgacgcgcgcgcgcaggcgagcgtgatcgtc
acgttctacgcgcccgccgatcccgcgtatgcgttcccggcgttctacgcggccgtgcgc
gacgcgggctacgtgctgtatccgggcaagctgacgacggccgacacgtttcgcgtcggc
tgcatcggcgcgctcggcgccgacgagatgcgcggcgcggtggcggcgatcggcggcgcg
ctcgaatcgctcggaatcgcgatgcggtga

DBGET integrated database retrieval system