KEGG   Burkholderia pseudomallei 668: BURPS668_A0588
Entry
BURPS668_A0588    CDS       T00481                                 

Gene name
phnA
Definition
(GenBank) phosphonoacetate hydrolase
  KO
K19670  phosphonoacetate hydrolase [EC:3.11.1.2]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00440  Phosphonate and phosphinate metabolism
bpd01100  Metabolic pathways
bpd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BURPS668_A0588 (phnA)
Enzymes [BR:bpd01000]
 3. Hydrolases
  3.11  Acting on carbon-phosphorus bonds
   3.11.1  Acting on carbon-phosphorus bonds (only sub-subclass identified to date)
    3.11.1.2  phosphonoacetate hydrolase
     BURPS668_A0588 (phnA)
SSDB
Motif
Pfam: Phosphodiest
Other DBs
NCBI-ProteinID: ABN86207
UniProt: A3NGX2
LinkDB
Position
II:554513..555784
AA seq 423 aa
MNEGPEGRNTMNRHIEVNGRVYRMPAEPTVAVCVDGCEYDYLEEAASAGVAPFLARMLRE
GSAFQADCVIPSFTNPNNLSIVCGAPPSVHGICGNFFWDQNAQGGAGAAVMMNDPAYLRA
GTLLAAAADAGAKVAVVTAKDKLRRLLGWRMRGVCFSAEKANQANLGENGIADVLDFVGL
PSPDVYSAALSEFVLAAGVRLAQSRRADLMYLSTTDYVQHKCAPGSEGANAFYAMMDRYL
AALDALGWVIGVTADHGMNAKHDPRTGEPNVVYLQDALDAWLGPRLARVILPITDPYVVH
HGALGSFATIYVEQGVDAGTVIGRLREFDGVELALDNATAAERFELPADRIGDVVVVGRR
DVVLGTRAREHDLSGLTVPLRSHGGLSEQRVPLLFNRRIEHVEPGRRLRNFDLFDLALNR
TVQ
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgaacgaagggcccgaagggcgaaacaccatgaatcgacacatcgaagtcaacggccgc
gtctaccggatgccggccgagccgacggtggccgtgtgcgtcgacggctgcgaatacgac
tacctcgaagaagccgcgagcgcgggcgtcgcgccgttcctcgcgcggatgctgcgcgag
ggctcggcgttccaggccgactgcgtgatcccgtcgttcaccaacccgaacaacctgtcg
atcgtgtgcggcgcgccgccgtcggtgcacggcatttgcgggaacttcttctgggaccag
aacgcgcagggcggcgcgggcgccgcggtgatgatgaacgatcccgcctacctgcgcgcg
ggcacgctgctggcggccgcggcggatgcgggcgcgaaggtcgccgtcgtgacggcgaag
gacaagctgcgccggctgctcggctggcgcatgcgcggcgtgtgcttctcggcggagaag
gcgaaccaggcgaatctcggcgagaacggcatcgccgacgtgctcgacttcgtcggcctg
ccgtcgcccgacgtctacagcgcggcgctgtcggagttcgtgctcgcggcgggcgtgcgg
ctcgcgcagagccggcgcgcggacctgatgtacctgtcgacgaccgattacgtgcagcac
aaatgcgcgccgggcagcgagggcgcgaacgcgttctacgcgatgatggaccgctacctc
gcggcgctcgacgcgctcggctgggtgatcggcgtgaccgcggaccacgggatgaacgcg
aagcacgatccgcgaaccggcgagccgaacgtcgtctatctgcaggacgcgctcgacgca
tggctcgggccgcgcctcgcacgcgtgatcctgccgatcaccgatccttacgtcgtccac
cacggcgcgctcggctcgttcgcgacgatctacgtcgagcaaggcgtcgacgcgggcacg
gtgatcggccggctgcgcgagttcgacggcgtcgagcttgcgctcgacaacgcgacggcc
gccgagcgcttcgagctgccggccgaccggatcggcgacgtcgtcgtcgtgggccggcgc
gacgtcgtgctcggcacgcgcgcgcgcgagcacgatctgtcgggcttgacggtgccgctg
cgctcgcacggcggcctgtccgagcagcgcgtgccgctgctgttcaaccgccggatcgag
cacgtcgagccgggtcgccggctgcgcaacttcgatctgttcgacctcgcgctgaaccgg
accgtgcaatga

DBGET integrated database retrieval system