KEGG   Burkholderia pseudomallei 668: BURPS668_A0589
Entry
BURPS668_A0589    CDS       T00481                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00206  phosphonoacetaldehyde dehydrogenase [EC:1.2.1.-]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00440  Phosphonate and phosphinate metabolism
bpd01100  Metabolic pathways
bpd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BURPS668_A0589
Enzymes [BR:bpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BURPS668_A0589
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: ABN88546
UniProt: A3NGX3
LinkDB
Position
II:555781..557235
AA seq 484 aa
MTTMPLRDHAAYRRETLRWCGQRAARARTLDVFDPYSGLRVGTVPLATVDDVRRAFDYAV
AYRPALSRYARSQILERAAARLTARAEEASTLISLESGLSKQDSRYEIGRVADVFKFASI
EALRDDAQSYSCDLTPHGKSRRVFSQRQPLDGVIVAITPFNHPMNQVAHKIAPAIATNNR
VIVKPSEKVPLSALYLADVLYEAGLPEPMLQVLTGDPREIADELLTHPSATLITFTGGVA
IGKSIAAKAGYRRIVLELGGNDPLIVLDDADLERAAALAAQGSYKNSGQRCTAVKRILVH
KRVAPRFTELLVEHTRAWTYGDPFDPANRMGTVIDEAAAALFEARVDEAVAQGARLLTGN
ARRGALYAPTVLDRVDASMTLVREETFGPVSPIIAFDTIDDAIRISNGTAFGLSSGVCTD
RADAIVRFVNELNVGTVNVWEVPGYRLELTPFGGIKDSGLGYKEGVQEAMKSFTNLKTFS
LPWA
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgacgacgatgccgcttcgcgatcacgccgcctaccgccgcgagacgctgcgctggtgc
gggcaacgggcggcgcgtgcgcgcacgctcgacgtattcgatccgtattcggggctgcgc
gtcggcaccgtgccgctcgcgacggtcgacgacgtgcgccgcgcgttcgactatgcggtc
gcgtaccggcctgcgctgtcgcgctacgcgcgctcgcagatcctcgagcgcgcggccgca
cgcctcaccgcgcgcgcggaagaggcgtcgacgctgatctcgctcgaatcggggctgtcg
aaacaggattcgcgctacgagatcggccgcgtcgccgacgtgttcaagttcgcgtcgatc
gaggcgctgcgcgacgatgcgcagagctactcgtgcgatctgacgccgcacggcaagtcg
cgccgcgtgttctcgcagcgccagccgctcgacggcgtgatcgtcgcgatcacgccgttc
aatcatccgatgaaccaggtcgcgcacaagatcgcgccggcgatcgcgacgaacaaccgc
gtgatcgtgaaaccgtcggagaaggtgccgctgtcggcgctgtatctcgccgacgtgctg
tacgaagcgggcctgcccgagccgatgctgcaggtgctgacgggcgatccgcgcgagatc
gccgacgaactgctcacgcacccgagcgcgacgctgatcacgttcacgggcggcgttgcg
atcggcaagtccatcgcggcgaaggcgggctaccggcgcatcgtgctcgagctgggcggc
aacgatccgctgatcgtgctcgacgatgccgatctcgaacgcgcggccgcgctcgccgcg
cagggctcgtacaagaactccggccagcgctgcacggcggtcaagcgcatcctcgtgcac
aagcgcgtcgcgccgcgcttcacggagctgctcgtcgagcacacgcgcgcatggacgtac
ggcgatccgttcgacccggcgaaccggatgggcaccgtgatcgacgaggcggcggccgcg
ctgttcgaggcgcgcgtcgacgaagcggtggcgcagggcgcgcgcctgctgacgggcaac
gcgcggcgcggcgcgctgtatgcgccgacagtgctcgatcgcgtcgacgcatcgatgacg
ctcgtgcgcgaggagacgttcggccccgtgtcgccgatcatcgcgttcgatacgatcgac
gacgcgatccgcatcagcaacggcaccgcgttcggcctgtcgtcgggcgtgtgcacggat
cgcgccgacgcgatcgtgcgcttcgtcaacgagctgaacgtcggcacggtgaacgtatgg
gaagtgccgggctaccggctcgagctcacgccgttcggcggcatcaaggattccgggctc
ggatacaaggaaggggtgcaggaggcgatgaagagcttcacgaacctgaagacgttttct
ttgccgtgggcgtga

DBGET integrated database retrieval system