KEGG   Burkholderia pseudomallei 668: BURPS668_A0756Help
Entry
BURPS668_A0756    CDS       T00481                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bpd  Burkholderia pseudomallei 668
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BURPS668_A0756 (ahpF)
Enzymes [BR:bpd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BURPS668_A0756 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 Glutaredoxin FAD_oxidored NAD_binding_7 FAD_binding_3 DAO HI0933_like Thi4 AlaDh_PNT_C NAD_binding_8 K_oxygenase FMO-like Ribosomal_S9
Motif
Other DBs
NCBI-ProteinID: ABN85578
UniProt: A3NHD4
LinkDB All DBs
Position
II:complement(722969..724576)
Genome map
AA seq 535 aa AA seqDB search
MLDAHLKTQLKSYLERITRPVELVASLDAGDQSRELRALLDEIAALSPQIFVTERRDAAE
RAPSFSVGEPGKAAGIRFAGMPMGHEFTSLVLALLQTGGHPIKLDDATIEQIRALDGDYA
FETYISLTCQNCPEVVQALNVMALVNPRIRHVMIDGALFQDEVEARRIMAVPTIFLNGET
FGQGRSSVKEILAKLDGGASRRAAQALAEKPVFDMLIVGGGPAGAAAAIYAARKGISTGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDVIDVERADRLVPGRVHE
IRLASGAVLKAKTVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGLAAAVTLIEYGEQLRADDVLQRKLRSLANVTVITQARTTELTGDGAKL
NGLVYEDRRTGEAKRIALEGVFVQIGLVPNTEWLKETVELSRHGEIVVDARGATSVPGVF
AAGDVTTVPYKQIVIAVGEGAKASLGAFDHLIRSEAHAVQAADTEASANAEAMAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcccatctcaagactcagttgaaatcgtacctcgaacggatcacgcgcccc
gtcgagctcgtcgcatcgctcgacgcaggcgaccagtcgcgcgaattgcgcgcgctactc
gacgagatcgcggcgctgtcgccgcagatcttcgtgaccgagcgccgcgacgcggctgag
cgcgcgccgtcgttctcggtcggcgagccgggcaaggccgcgggtattcgcttcgccggt
atgccgatgggccacgaattcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccgatcaagctcgacgacgcgacgatcgagcagatccgcgcgctcgacggcgactacgca
ttcgagacgtatatctcgctcacctgccagaactgcccggaagtcgtgcaggcgctcaac
gtgatggcgctcgtcaacccgcgcatccgccacgtgatgatcgacggcgcgctgttccag
gacgaagtcgaggcgcgccggatcatggccgtgccgacgatcttcctgaacggcgagacg
ttcggccagggccgcagcagcgtgaaggagatcctcgcgaaactcgacggcggcgcgagc
cggcgcgcggcgcaggcgctcgcggagaaacccgtgttcgacatgctgatcgtcggcggc
ggccccgcgggcgcggcggcggcgatctacgcggcgcgcaagggcatctcgacgggcgtc
gtcgccgagcgcttcggcggccaggtgctcgatacgatggcgatcgagaatttcgtgtcg
gtccaggaaaccgaggggccgaagttcgcgaccgcgctcgagcagcacgtgaagcaatac
gatgtcgacgtgatcgacgtagagcgcgccgaccggctcgtgccgggccgcgttcatgaa
attcgcctcgcgagcggcgcggtgctgaaggcgaagaccgtcgtgctcgcgacgggcgcg
cgctggcgcgagatcggcgtgcccggcgagcgcgagtatcgcaaccgcggcgtcgcgtac
tgcccgcattgcgacgggccgctcttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggtgtcgaggcggcgatcgatctcgccggccttgccgccgccgtgacgctgatc
gaatacggcgagcagttgcgtgcggacgacgtgctgcaacgcaaactgcgcagcctcgcg
aacgtgacggtgatcacgcaggcacgcacgaccgagctcacgggcgacggcgcgaagctg
aacgggctcgtctacgaggacaggcgcacaggcgaggcgaagcgcatcgcgctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaaggaaaccgtcgagctg
tcgaggcacggcgagatcgtcgtcgacgcgcgcggcgcgacgtcggtgcccggcgtgttc
gccgccggcgacgtgacgacggtgccgtacaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcatcgctcggcgcattcgaccacctgattcgaagcgaggcgcatgccgtgcag
gcggcggataccgaagcttcggcaaacgccgaggccatggccgcctga

DBGET integrated database retrieval system