KEGG   Burkholderia pseudomallei 668: BURPS668_A0778
Entry
BURPS668_A0778    CDS       T00481                                 

Definition
(GenBank) 2-aminoethylphosphonate aminotransferase family protein
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00440  Phosphonate and phosphinate metabolism
bpd01100  Metabolic pathways
bpd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BURPS668_A0778
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpd01007]
    BURPS668_A0778
Enzymes [BR:bpd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     BURPS668_A0778
Amino acid related enzymes [BR:bpd01007]
 Aminotransferase (transaminase)
  Class V
   BURPS668_A0778
SSDB
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Aminotran_1_2 Beta_elim_lyase SHMT
Other DBs
NCBI-ProteinID: ABN87908
UniProt: A3NHF6
LinkDB
Position
II:complement(746708..747775)
AA seq 355 aa
MLLLNPGPVTLTERVRQSLLQPDLCHRESEFFDLQDEARARLVAAYALDPAEWSAVLMTG
SGTAAVESMIAALVPENGKLLVIENGVYGERITQIATQYRIAHDVLKHDWMQAPDLARVA
EKLDADRAITHVAVIHHETTTGRLNDLDALAAVCRARGVRMLVDGVSSFGAEAIDFAGGD
IDALAATANKCLHGVPGAAFVIVRRRALASAASRTYYLDLGRLAKLQDARNTPFTPSVHA
YYALVEALREFDEAGGWRARHARYAALAEQVRAGLAARGMPLVLPDGESSVVLRAYRLPA
GVAYEQLHDGLKARGFVIYAGQGGLSSALFRVSTMGAIEPADVERLLDGFTALAR
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgctgttgctgaatcccggtcccgtgacgctgacggagcgtgtgcgccaaagcctgctg
cagccggacctgtgccaccgcgaaagcgaattcttcgatctgcaggacgaggcgcgcgcg
cggctcgtcgccgcgtacgcgctcgatccggccgaatggagcgcggtgctgatgacgggc
tccggcacggccgcggtcgagagcatgatcgccgcgctcgtgccggaaaacggcaagctg
ctcgtgatcgagaacggcgtgtacggcgagcggatcacgcagatcgcgacgcagtaccgg
atcgcgcacgacgtgctgaagcacgactggatgcaggcgccggatctcgcgcgcgtcgcc
gagaagctcgacgcggatcgcgcgatcacgcatgtcgcggtgatccatcacgaaacgacc
acgggccgcctgaacgacctcgacgcgctcgccgccgtgtgccgcgcgcgcggcgtgcgc
atgctcgtcgacggcgtgagcagcttcggcgcggaggcgatcgatttcgcgggcggcgac
atcgacgcgctcgccgcgaccgcgaacaagtgcctgcacggcgtgccgggcgcggcgttc
gtgatcgtgcgccgccgcgcgctcgcgagtgccgcgagccgcacctactacctcgatctc
ggccggctcgcgaagctgcaggacgcgcgcaacacgccgttcacgccgtcggtgcacgcg
tactacgcgctcgtcgaggcgctgcgcgagttcgacgaggcgggcggctggcgcgcgcgc
cacgcgcgctacgcggcgctcgccgaacaggtgcgcgccggcctcgccgcgcgcggcatg
ccgctcgtgctgccggacggcgaatcgtcggtcgtgctgcgcgcgtaccggctgcccgcc
ggcgtcgcgtacgagcaactgcacgacggcctgaaagcgcgcggcttcgtgatctacgcg
ggccagggcgggctgtcgagcgcgttgttccgcgtgtcgacgatgggcgcgatcgagccc
gcggacgtcgagcgcctcctcgacggattcaccgcgctcgcgcgctga

DBGET integrated database retrieval system