KEGG   Burkholderia pseudomallei 668: BURPS668_A0779
Entry
BURPS668_A0779    CDS       T00481                                 

Gene name
aepY_2
Definition
(GenBank) phosphonopyruvate decarboxylase
  KO
K09459  phosphonopyruvate decarboxylase [EC:4.1.1.82]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00440  Phosphonate and phosphinate metabolism
bpd00998  Biosynthesis of various secondary metabolites - part 2
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
bpd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BURPS668_A0779 (aepY_2)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BURPS668_A0779 (aepY_2)
Enzymes [BR:bpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.82  phosphonopyruvate decarboxylase
     BURPS668_A0779 (aepY_2)
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_N
Other DBs
NCBI-ProteinID: ABN85990
UniProt: A3NHF7
LinkDB
Position
II:complement(747790..748971)
AA seq 393 aa
MIEAAQFVEAARARGFDWYAGVPCSYLTPFINYVLQDPALHYVSAANEGDAVALVAGATL
GGRRGIAMMQNSGLGNAVSPLTSLTWTFRLPQLLIVTWRGQPGVPDEPQHALMGPITPAM
LDTMEIPWETFPTQADAIGPALDRAIAHMDATGRPYALVMQKGSVAPHALEHASMPERRA
HAAARATPGAAAPSAWPTRHDALARIVARTPADSTVVLASTGFCGRELYALDDRPNQLYM
VGSMGCVTPLALGLALARPDLTVVALDGDGAALMRMGAFATLGAYGPPNLVHLLLDNGAH
ESTGGQATVSQYVSFAGIAAACGYATAIEGDDLGVLDAALDAARAGEQAVEHGGAHFARL
SIRTGVPDGLPRPTVTPVDVKTRLMRHIGAMPA
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgatcgaagccgcgcagttcgtcgaagcggcgcgcgcgcgcggcttcgactggtacgcg
ggcgtgccctgctcgtatctgacgccgttcatcaattacgtgctgcaggacccggcgctc
cattacgtatcggcggccaacgaaggcgacgcggtcgcgctcgtcgcgggcgcgacgctc
ggcggccggcgcgggatcgcgatgatgcagaactcggggctcggcaacgcggtgagcccg
ctcacgtcgctcacgtggacgttcaggctgccgcagctcctgatcgtcacgtggcgcggc
cagccgggcgtgcccgacgagccgcagcacgcgctgatgggcccgatcacgcccgcgatg
ctcgacacgatggaaattccgtgggagacgttcccgacgcaggccgacgcgatcggcccg
gcgctcgatcgcgcgatcgcgcacatggacgcgacgggccgcccgtacgcgctcgtgatg
cagaaaggcagcgtcgcgccgcacgcgctcgagcatgcctcgatgcccgagcgccgcgcg
cacgccgccgcgcgcgcgacgcccggcgcggccgcgccttcggcatggccgacgcgccat
gacgcgctcgcgcggatcgtcgcgcgcacgccggccgactcgacggtcgtgctcgcgtcg
acgggcttctgcggccgcgagctgtacgcgctcgacgatcgcccgaaccagctctacatg
gtcggctcgatgggctgcgtgacgccgctcgcgctcggcctcgcgctcgcgcggccggac
ctgaccgtcgtcgcgctcgacggcgacggcgccgcgctgatgcgcatgggcgcgttcgcg
acgctcggcgcgtacggcccgccgaacctcgtgcatctgctgctcgacaacggcgcgcat
gaatcgacgggcgggcaagccacggtgtcgcaatacgtgtcgttcgcgggcatcgcggcc
gcatgcggctacgcgacggcgatcgagggcgacgatctcggcgtgctcgatgcggcgctc
gacgcggcgcgcgcgggcgagcaggccgtcgagcacggcggcgcgcacttcgcgcgcctg
tcgatccgcacgggcgtgcccgacggcctgccccgcccgacggtgacgcccgtcgacgtg
aaaacgcgcctgatgcgccacatcggcgcgatgccggcctga

DBGET integrated database retrieval system