KEGG   Burkholderia pseudomallei 668: BURPS668_A0910
Entry
BURPS668_A0910    CDS       T00481                                 

Definition
(GenBank) putative hydrolase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00440  Phosphonate and phosphinate metabolism
bpd00998  Biosynthesis of various secondary metabolites - part 2
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
bpd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BURPS668_A0910
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BURPS668_A0910
Enzymes [BR:bpd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BURPS668_A0910
SSDB
Motif
Pfam: PEP_mutase Raf1_HTH ThiG
Other DBs
NCBI-ProteinID: ABN87283
UniProt: A3NHT8
LinkDB
Position
II:complement(888573..889484)
AA seq 303 aa
MPIRELISAPITNEQRRRSFKEKLATGRALRFIESHSPISAMISEKVYVAHGASQSEFDG
FWSSSLTDSTLRGRPDIEILDIASRLANVQHIFDVTTKPLIIDGDTGGKPEHFALNVQSL
ERSGVSAVIIEDKTGLKKNSLLGNDVVQHQESIEDFCEKIRVGKAAQITDDFQIIARVES
LILDKGMPDALARAAAYCEAGADGVMIHSRKKDADEVIEFAQRFRACRRDAYLVCVPTSF
NAISFSELARHFSVVIYANHLLRAAYPAMLAVAEGILAHGRTLEIEERCLPVNEILKLIP
GTA
NT seq 912 nt   +upstreamnt  +downstreamnt
gtgccaataagagaattaataagcgcgccgattaccaacgaacaaagacgccgatcgttc
aaggaaaagctggcaaccgggcgcgcgctgcgcttcatcgaaagccacagcccgatttcc
gcaatgatcagcgaaaaggtttatgttgcgcacggagcgtctcaatccgagttcgacggc
ttctggtcgagttcactgaccgactcgacgctgcgcggccggccggacatcgaaatcctg
gatatcgcgagcaggctcgccaatgtccagcatattttcgacgtgacgacgaagccgctc
atcatcgacggcgacacgggcggcaagcccgagcatttcgcgctgaacgtgcagtcgctc
gagcgatccggcgtctcggcggtgatcatcgaggacaaaacggggttgaagaaaaattcg
ctgctcggcaacgacgtggttcagcaccaggaatcgatcgaggatttctgcgaaaagatt
cgcgtcggcaaggccgcgcagatcaccgacgattttcagatcatcgcccgcgtcgagagc
ctgattctcgacaagggcatgccggacgcgctcgcgcgcgcggccgcgtattgcgaggcc
ggcgccgacggcgtgatgatccacagccgcaagaaggacgcggacgaagtgatcgaattc
gcgcagcggttccgcgcatgccgccgcgacgcgtatctcgtgtgcgtgccgacgagcttc
aacgcgatttcgttcagcgagctcgcgcgccacttcagcgtcgtgatctacgcgaatcac
ctgctgcgcgccgcgtatccggcgatgctcgcggtcgccgagggcattctcgcgcacggc
cgcacgctcgagatcgaagaacgctgcctgcccgtcaacgagatcctgaagctcattccg
ggaaccgcgtga

DBGET integrated database retrieval system