KEGG   Bordetella pseudohinzii: BBN53_03110Help
Entry
BBN53_03110       CDS       T04945                                 

Definition
(GenBank) protein TolA
  KO
K03646  colicin import membrane protein
Organism
bpdz  Bordetella pseudohinzii
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpdz02000]
    BBN53_03110
Transporters [BR:bpdz02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BBN53_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_2 TonB_C TFIIA
Motif
Other DBs
NCBI-ProteinID: ANY14973
UniProt: A0A0J6BW57
LinkDB All DBs
Position
complement(662659..663729)
Genome map
AA seq 356 aa AA seqDB search
MPPIIRSDSKTPWSPERKDNAKSLGLATLVHILLIVVLFFGLNWHTQNPGPVQVELWMDG
DTPDAAPPTPTPEPEPEPPKPQPEPPKPQPEPEPPKPEPKPEPPPPPQAQPEPQPDPEIA
LEEARKKREQEEKARQAAEAAKEKARREEERRQAELKEKQRLEQERKAAEQKAKEEADKK
AKEDAAKKAAAEKAAAEKAAAEKAAEQKAKEEAAKKAAAEKKAKEEAAKKAAADKALRDA
FRNDILGTAGRPGGTADRNQAGGGRDDGYGAKVRACVQPGVAYPAPPRAGSANPTAEYRV
QLGSDGRVGNVTLKRSSGNTAFDRAVETGIRRCNPFPKPSTGRYEPIIDVVYRMYD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgattattcgatccgacagcaaaaccccgtggtccccagagcgcaaggacaat
gccaagtccctgggcctggcgacgctggtgcacatcctgttgatcgtcgtgcttttcttc
ggcctgaactggcatacgcagaaccccggcccggtgcaggtcgaactgtggatggacggc
gacacgcccgacgcggcgccgcccacccccacgcccgaacccgagcccgagccgcccaag
ccgcagcccgagccccccaagccccagccggaaccggagccgcccaagcccgaacccaag
ccggagcccccgccgcctccccaggcccagcccgagcctcagcccgatcccgagatcgcg
ctcgaagaggctcgcaagaaacgcgaacaggaagaaaaagcccgccaggccgctgaagcc
gcgaaagaaaaggcgcgccgggaagaagaacgccgtcaggccgagctgaaggaaaagcag
cgcctggagcaagagcgcaaggccgccgaacagaaagccaaggaagaggccgacaagaag
gccaaggaagacgccgccaagaaggccgccgccgaaaaggctgctgccgagaaggccgcc
gcggaaaaagccgcggagcagaaagccaaggaagaggcggccaagaaggctgccgccgag
aagaaggccaaggaagaagccgccaagaaggccgccgccgacaaggcgctgcgcgatgcc
ttccgcaacgacatcctcggcaccgcgggccgccccggcggcaccgcggaccgcaaccag
gcaggcggcggccgcgacgatggctatggcgccaaggtccgcgcctgcgtgcagcccggt
gtggcatatccggcgccgccgcgcgccggctcggccaatcccacggcggaataccgggta
cagttaggaagtgatggcagggtgggcaacgtgacgctgaagcgctcctccggcaatacc
gcctttgaccgcgcggtcgagaccggcatccggcgctgcaaccccttccccaagccttcg
acgggccgctacgagcccatcatcgacgtcgtataccgtatgtatgattga

DBGET integrated database retrieval system