KEGG   Bordetella pseudohinzii: BBN53_05685Help
Entry
BBN53_05685       CDS       T04945                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
bpdz  Bordetella pseudohinzii
Pathway
bpdz03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BBN53_05685
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bpdz03400]
    BBN53_05685
Enzymes [BR:bpdz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     BBN53_05685
DNA repair and recombination proteins [BR:bpdz03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BBN53_05685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG DUF3391
Motif
Other DBs
NCBI-ProteinID: ANY18201
LinkDB All DBs
Position
1259801..1260649
Genome map
AA seq 282 aa AA seqDB search
MAELRVNPLQRLWLREIGIEKTWLRGAPDSAPAPARDVQARPAVTAQAPPAARSAPEAPR
PSRPEPRPASKPEPAPTVAEASAPASAGIEVARRVAGFDLAQLQQEVLACTACGLCQGRK
HAVFGDGARPARWLVVGEAPGEQEDRRGLPFVGRSGQLLDAMLASVGMSRERDVFIANVI
KCRPPGNRNPKPEEIAACSPYLMRQIALLEPERILVLGRFAAQTLLGTDATIGSLRGRRH
VLKTEAGREIPVVVSYHPAYLLRSPSEKARAWQDLQLALRAA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctgcgtgtcaatccgctgcagcgcctctggctgcgcgaaatcggcatcgaa
aagacctggctgcgcggcgcgccggacagcgcgccggcgcccgcgcgcgacgtccaggcg
cgtcccgcggtcaccgcgcaggcgccgcccgcggcccgctccgcgcccgaggcaccccgg
ccgtcccggcccgagcctcggcccgcttccaagcccgaaccggcgcccacggtggccgag
gcctcggcgccggccagcgccggcatcgaggtggcaaggcgcgtggccggcttcgatctg
gcgcaattgcagcaggaggtgctggcctgcacggcctgcggcctgtgccagggccgcaag
catgcggtgtttggcgatggggcccggccggcgcgctggctggtggtgggcgaggcgccc
ggcgagcaggaagaccggcgcgggctgcccttcgtgggccgttccggccagttgctcgac
gccatgctggcctcggtgggcatgagccgcgagcgtgacgtcttcattgccaatgtgatc
aagtgccgcccgcccggcaaccgcaatcccaagcccgaggaaatcgccgcctgcagtccc
tacctcatgcgccagatcgccttgctggaacccgagcgcatcctggtgctggggcgtttc
gcggcccagaccctgctgggcacggatgccaccataggcagcctgcgggggcgcaggcat
gtcctgaagaccgaggcgggacgggagatcccggtggtggtgagctaccacccggcctat
ctgctgcgcagcccctccgagaaggcgcgggcctggcaggacctgcagctggccctgcgg
gccgcttga

DBGET integrated database retrieval system