KEGG   Bordetella pseudohinzii: BBN53_09875Help
Entry
BBN53_09875       CDS       T04945                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bpdz  Bordetella pseudohinzii
Pathway
bpdz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BBN53_09875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpdz02000]
    BBN53_09875
Enzymes [BR:bpdz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BBN53_09875
Transporters [BR:bpdz02000]
 Other Transporters
  Pores ion channels [TC:1]
   BBN53_09875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C_3 GST_N_2 GST_C GST_N_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ANY16176
UniProt: A0A0J6C2Q8
LinkDB All DBs
Position
complement(2153875..2154498)
Genome map
AA seq 207 aa AA seqDB search
MSRWTFYTAPGTCALATHIALHEAGAEFDLVKLDMSANQQQSPAYLSVNPKGRVPALATE
RGVLTETPALLAFVAQSFPAARLAPLDDPFAFARMQELASYLASTAHVAHAHKRRGARWA
DDAAAQEAMRAKVPQTMTACAAYLESQIAGPWVAGEAYSAVDGYLFTIGSWLEGDGVDMS
QFPKLSDYLARMAARPAVQRALAEAQA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgctggactttctacaccgcccccggcacctgcgcgctggccacccatatcgcc
ctgcatgaagccggcgcggagttcgacctggtcaagctggacatgtcggccaaccaacag
caaagcccggcctatctgagcgtcaatcccaaaggccgcgtgccggccctggccaccgag
cgcggcgtgctgaccgagacccccgccctgctggcctttgtcgcccaaagtttcccggcc
gcgcgcctggcgcccctggacgacccctttgccttcgcgcgcatgcaggagctggcgagc
tacctggcctcgaccgcccacgtcgcgcatgcgcacaagcgccgcggcgcgcgctgggcc
gatgacgcggccgcgcaggaagccatgcgcgccaaggtgccgcagaccatgacggcttgc
gcggcctatctggaatcgcagatcgccggcccctgggtggctggcgaggcctatagcgcc
gtcgacggctatctcttcaccatcggcagctggctggaaggcgacggcgtggacatgagc
caattccccaagctgtccgactacctggcccgcatggccgcccgcccggccgtgcagcgc
gccctggccgaggcccaggcctga

DBGET integrated database retrieval system