KEGG   Bordetella pseudohinzii: BBN53_12890Help
Entry
BBN53_12890       CDS       T04945                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
bpdz  Bordetella pseudohinzii
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BBN53_12890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB MarR_2 HTH_27 DUF334
Motif
Other DBs
NCBI-ProteinID: ANY16705
UniProt: A0A0J6BUQ1
LinkDB All DBs
Position
2837881..2839227
Genome map
AA seq 448 aa AA seqDB search
MDPTAETAEGDSPPRPRRRSWIRRVVHALRFAAHRADEERLFQVASSLTFTTVLAIVPML
AVVLSLFTAFPVFQDFRLALEDFLANNLMPPAVSDNIMNYLNQFARQATRLTTIGSAFLI
VTSLLLIMTIDKTFNDIWHVSRQRPWPQRALVYWAVITLGPVAASASLWATSFVARESLG
LVQDVPEVVSLAISFIPLLLTGLGFAALFVVVPNCRVYWRDALTGGFCTAIALEVMKSGF
ALYLTRFPAYTVIYGTFATLPIFLLWIYLSWLAVLFGASIAASAPMIRLGRWEINRAAGA
QFIDAVGVLRLLMAARGQRPPGRSTQMLCRQLHLHHDELNAVLAALHAMGLVAPTGDDRW
ILAANPQSTPLTPLYDRFLLDRQQRRVRLDPSLSMLATRLADPENAPKLEELASLSHNRG
IGPTPDDDFERETRPITVLPLENAKKPK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggacccgaccgccgaaaccgccgaaggggactccccacccaggccgcgccgccgctcc
tggatacggcgcgtggtgcacgcgcttcgtttcgccgcgcaccgcgccgatgaagaacgc
ctgtttcaagtcgcctccagcctgaccttcaccaccgtattggccatcgtgccgatgctg
gccgtcgtgctgtcgctgtttaccgcctttccggtcttccaggatttccgcctcgcgctc
gaagacttcctggcgaacaacctcatgccgccggcggtctccgacaacatcatgaactat
ctcaaccagttcgcgcggcaggccacgcggctgacgacgataggcagcgccttcctgatc
gtgacctcgctcttgcttatcatgacgatagacaagaccttcaacgatatctggcacgtc
agccgccagcggccctggccgcagcgggccctggtctactgggccgtcatcaccctgggc
ccggtggccgccagcgccagcctctgggcgacctccttcgtggcgcgggaatcgctgggg
ctggtccaggacgtgccggaagtcgtcagcctggcgatctctttcattcccttgctgctc
accggcctgggcttcgcggccctgttcgtggtggtgcccaattgccgcgtctactggcgc
gacgccctgaccggcggcttctgcaccgccatcgcgctcgaagtgatgaaatccggtttc
gccctgtacctgacccggtttcccgcctacaccgtcatctacggcaccttcgccaccctg
cccatcttcctgctgtggatctatctctcctggctggccgtgctgttcggcgccagcatc
gccgccagcgcgccgatgatccggctgggccgctgggagatcaaccgcgccgcgggcgcg
cagttcatcgacgcggtgggcgtgctgcgcctgctgatggccgcgcgcggacagcgcccg
ccaggacgcagcacccagatgctctgccgccagttgcatctgcaccacgacgagctcaat
gccgtcctggcggccctgcatgcgatggggctggtcgccccgaccggggacgaccgctgg
atcctggcggccaacccgcaatccacgccgctcacgcccctttacgatcgattcctgctc
gacaggcagcagcggcgtgtccgtcttgatccgtccctgagtatgctggccacccggctg
gccgacccggaaaacgcccccaagttggaagaactcgccagcctgtcgcacaataggggc
atcgggccaacgccagacgacgatttcgagcgcgaaacgcgccccatcaccgtgctgccg
ctggagaatgccaaaaagcccaagtaa

DBGET integrated database retrieval system