KEGG   Bordetella pseudohinzii: BBN53_16565Help
Entry
BBN53_16565       CDS       T04945                                 

Gene name
dppD
Definition
(GenBank) dipeptide ABC transporter ATP-binding protein DppD
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
bpdz  Bordetella pseudohinzii
Pathway
bpdz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBN53_16565 (dppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpdz02000]
    BBN53_16565 (dppD)
Transporters [BR:bpdz02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BBN53_16565 (dppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_22 TniB AAA_29 AAA_16 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ANY17344
UniProt: A0A0J6C018
LinkDB All DBs
Position
3593640..3594641
Genome map
AA seq 333 aa AA seqDB search
MSGKEIVLAVDGLKTWFHSRDGVAKSVDGVTFELARGETLAIVGESGSGKSVTSLSIMGL
LPKPAGRIEAGAIRFKDRRGKAHDLARADAATLRRIRGAEIAMIFQEPMTSLNPLFTVGD
QIAEAVLQHEGGSHAAALRRAKEMLERVEIPAAARRVNEYPHQMSGGMRQRVMIALALAC
NPSVLIADEPTTALDVTVQAQILDLLRRLQQESGMSILFVTHNLGVVAEIAHRVAVMYAG
RVVEDADVYSLFERPTHPYTRGLLSCIPTAALLASRQRLQAIPGNVPSVLSLPPGCTFAP
RCPLADEGCAAAVPELLAVQPAHRARCFKVAAA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaaagaaatcgtcctggccgtcgacggcctgaaaacctggttccacagccgc
gatggcgtggccaagtcggtcgacggcgtcactttcgagctggcgcgcggcgaaaccctc
gccatcgtgggcgaatccggctcgggcaaatcggtcaccagcctgtccatcatgggcctg
ctgcccaagccggccggccgcatcgaggccggcgccatccgcttcaaggaccggcgcggc
aaagcgcatgatctggcgcgcgccgacgcggccacgctgcgccgcatccgcggcgccgag
atcgccatgatcttccaggagcccatgaccagcctcaacccgctgttcaccgtgggcgac
cagatcgccgaggcggtcctgcagcacgagggcggttcgcatgccgccgccctgcggcgg
gccaaggaaatgctcgagcgcgtcgagatcccggccgccgcgcgccgggtcaacgagtac
ccgcaccagatgtcgggcggcatgcgccagcgcgtgatgatcgcgctggccctggcctgc
aacccctcggtgctcatcgccgacgagcccaccacggccctggacgtgaccgtgcaggcg
cagatcctggacctgctgcgccggctgcagcaggaaagcggcatgagcatcctcttcgtc
acgcataacctgggcgtggtggccgaaatcgcccaccgcgtggcggtcatgtatgccggg
cgcgtggtggaggatgccgatgtgtattccctcttcgagcgccccacccatccgtatacg
cgcggcctgctgtcctgcatcccgacggccgcgctgctggcctcgcgccagcggctgcaa
gccatccccggcaatgtgcccagcgtgctgtcgctgccgccgggctgcaccttcgcgccg
cgctgccccctggccgacgagggctgcgccgcggccgtgcccgaattgctcgccgtccaa
cccgcgcaccgcgcccgatgcttcaaggtagccgccgcatga

DBGET integrated database retrieval system