KEGG   Bordetella pseudohinzii: BBN53_17800Help
Entry
BBN53_17800       CDS       T04945                                 

Definition
(GenBank) ring-hydroxylating dioxygenase subunit beta
  KO
K16320  anthranilate 1,2-dioxygenase small subunit [EC:1.14.12.1]
Organism
bpdz  Bordetella pseudohinzii
Pathway
bpdz00627  Aminobenzoate degradation
bpdz01100  Metabolic pathways
bpdz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BBN53_17800
Enzymes [BR:bpdz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     BBN53_17800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_B SnoaL_4 SnoaL_2
Motif
Other DBs
NCBI-ProteinID: ANY17570
UniProt: A0A0J6EUD4
LinkDB All DBs
Position
3848227..3848745
Genome map
AA seq 172 aa AA seqDB search
MNQSNSYVPARLPLDRAVPLKAEIELFHAEYCAALDGGDVERWPDFFVADAVYRVTAREN
AELNLPVGLVYAEGRDMMHDRAVAISRTQMFAPRYLLHIVSGVRVIDADAAGQITSHASF
LLMQTLVEGPTTMHLAGVYQDVFVREDGVLRLKRRDVIYDTNILANDLVYPV
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagagcaatagctacgtgcccgcccgcctgccgctggaccgggccgtgcccctg
aaggccgagatcgagcttttccacgccgagtactgcgccgcgctggacggcggcgatgtc
gagcgctggcccgatttcttcgtcgcggacgccgtgtaccgcgtgaccgcgcgcgagaac
gccgaactgaatctgccggtcgggctggtctacgccgaaggccgcgacatgatgcacgac
cgcgccgtggcgatctcgcgcacgcagatgttcgcgccgcgctatctgctgcacatcgtc
agcggcgtgcgcgtcatcgacgcggacgccgccggccagatcacctcgcacgccagcttc
ctgctgatgcagaccctggtcgagggccccaccaccatgcacctggcgggcgtctaccaa
gacgtgttcgtgcgcgaggatggcgtgctgcgcctgaagcggcgcgacgttatctacgac
acgaatatcctggccaacgatctggtctatccggtgtga

DBGET integrated database retrieval system