KEGG   Bordetella pseudohinzii: BBN53_19060Help
Entry
BBN53_19060       CDS       T04945                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bpdz  Bordetella pseudohinzii
Pathway
bpdz00620  Pyruvate metabolism
bpdz00680  Methane metabolism
bpdz01100  Metabolic pathways
bpdz01120  Microbial metabolism in diverse environments
bpdz01200  Carbon metabolism
Module
bpdz_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBN53_19060
  09102 Energy metabolism
   00680 Methane metabolism
    BBN53_19060
Enzymes [BR:bpdz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BBN53_19060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase DUF3040
Motif
Other DBs
NCBI-ProteinID: ANY17799
UniProt: A0A0J6C772
LinkDB All DBs
Position
4124783..4127629
Genome map
AA seq 948 aa AA seqDB search
MNATRAQSELAEPLRNDIRLLGRYLGDVIQACEGKRVFDTIETLRRSAVRFRREGREADG
QLMQQLVKQLRSDDPNLVARAFSYFLHLFNIAEDRDQNRRQRARALADAAPAPGTLRQAV
QLLHAQGVSAQRIRRLIGEACVMPVLTAHPTEVQRKSTLDAHREIATLIAQRDQPLTSDE
SAELDSALLGRVDTLWQTRMLRNTRLTVADEIENALSYYRSTFLSAIPRLYGDLSKLLSP
EAANPFAAPPPPLEPFLRMGSWIGGDRDGNPNVDAGTLELALLRQATVVFEHYLNEVHAL
GAEISVTTLLSDASEALRQLADAGGDTSPHRRDEPYRRALIGVYARLAATARALTGRELA
LRSTVPAEPYPHPQALAQDLAVIAESLTRHHGAPIARLRLAGLQQAVEVFGFHLATLDLR
QSSDVHERVLTELFARASQDGRPLRYDLMDEAARVQLLRAELATARPLASPWIVYSEDTT
RELAVLRAAAAARARYGRAAVRQTIVSHTETLSDLLEVLVLQKETGLIAPAGAAPGAEDG
LMVVPLFETIPDLERGPSIMAAWLDLPEVRERVRLAQGESQEVMLGYSDSNKDGGYLTSN
WSLYRAERELVEVFRARHVKLRLFHGRGGSVGRGGGSSFDAILAQPPGTVAGQLRLTEQG
EVIQTKYKDAEIGRWHLELLVSAVLEATLAQQPAAARQAEDAHMAHHGLAMDALSAGARR
SYRQLVYDTPGFADYFFAATPINEIAGLNIGSRPASRKQGQKIEDLRAIPWGFSWAQCRL
MLTGWYGMGSALQAYLEDGADGAPRAKRSRLSQLREMARDWPAFRTLLSNMEMVLAKSDL
AIAQRYAMLVPQRGLRERIFGAISDEHARTLAMLKLINQRELLADNPALAASLRERFAYI
DPLNYLQIDLLRRHRASQKRSDTTPDPRITPAIHLTINGIAAGLRNSG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctacacgcgcgcagtctgaattggccgagcccctacgcaatgacatccgcctt
ctcgggcgctatcttggcgacgtgatccaggcctgcgaaggaaagcgggttttcgacacc
atcgagacactgcgccgcagcgcggtgcgctttcgccgcgaagggcgggaagccgacggg
cagctgatgcagcagctggtcaagcagctgcgctcggacgaccccaatctggtcgcgcgc
gccttcagctactttctgcacctgttcaacatcgccgaagaccgcgaccagaaccgccgc
cagcgcgcccgcgcgctggccgatgcggcgccggcgccgggcaccctgcgccaggccgtg
cagctgctgcacgcgcaaggcgtctcggcccagcgcatccgccgcctgatcggcgaggcc
tgcgtcatgccggtgctgacggcccaccccaccgaggtccagcgcaagagcacgctggat
gcgcatcgcgagatcgccacgctgatcgcgcagcgcgaccagccccttaccagcgatgaa
agcgccgaactggacagcgccctgctgggccgcgtggacacgctgtggcagacgcgcatg
ctgcgcaacacccgcctgaccgtggccgacgaaatcgagaatgcgctgagctattaccgc
agcacctttctgtcggccattccgcggctgtacggcgacctgtccaagctgctcagcccc
gaggcggccaaccccttcgccgcgccgcccccgccgctggagccttttctgcgcatgggc
agctggataggcggcgaccgcgacggcaatcccaatgtggacgccggcacgctggagctg
gccctgctgcgccaggccacggtggtgttcgagcactatctgaatgaagtccacgcgctg
ggcgcggaaatctccgtcacgaccctcttgagcgacgccagcgaagcgctgcggcagctg
gccgacgccggcggcgacacctcgccgcaccgccgcgacgagccctaccgccgcgccttg
atcggcgtctatgcgcgcctggccgccaccgcgcgcgccctgaccggacgcgagctggcg
ctgcgcagcaccgtgccggccgaaccctatccgcacccccaggccctggcgcaggacctc
gccgtgatcgccgaatcgctgacccggcaccacggcgcgcccatcgccaggctgcgcctg
gccggcctgcagcaagccgtcgaggtgttcggcttccatctggccacgctggacctgcgc
caaagctccgatgtgcacgagcgcgtgctgaccgagctgttcgcccgcgccagccaggac
ggccgtccactgcgctatgacctgatggacgaagcggcccgcgtgcaattgctgcgcgcc
gaactggccacggcccgcccgctggcttcgccctggattgtctacagcgaggacaccacg
cgcgaattggccgtcctgcgcgcggccgccgcggcccgcgcgcgctacggccgcgccgcc
gtgcgccagaccatcgtgtcgcacaccgaaaccctcagcgacctgctggaagtgctggtg
ctgcaaaaagaaaccggcctcatcgcgccggccggcgccgcccccggtgccgaggatggc
ctgatggtcgtgccgctgttcgagaccatccccgatctggagcgcggcccatccatcatg
gccgcctggctggaccttcccgaagtgcgcgagcgcgtgcgcctggcccagggcgagagc
caggaagtcatgctgggctattcggacagcaacaaggacggcggctatctgacgtccaac
tggtcgctctaccgcgccgagcgcgaactggtcgaggtattccgcgcccgccacgtcaag
ctgcgcctcttccatggccgcggcggctcggtgggccgcggcggcggctccagtttcgac
gccatcctggcgcagccgccgggcaccgtggccggccaattgcgcctgaccgaacagggc
gaagtcatccagaccaagtacaaggacgccgagatcggccgctggcacctggaactgctg
gtctcggccgtgctggaggccacgctggcgcagcagccggcggcggcccgccaggccgag
gacgcccacatggcgcatcatggcctggccatggacgcgctgtcggccggcgcgcggcgc
agctatcgccagctggtctacgacaccccgggctttgccgactacttcttcgcggccacg
cccatcaacgagattgccggcctgaacatcggctcgcgcccggcctcgcgcaagcaaggc
cagaagatcgaagacctgcgcgccattccgtggggattttcatgggcgcaatgccgcctc
atgctcaccggctggtacggcatgggatcggcgctgcaggcttacctcgaagacggggcc
gacggcgcgccgcgcgccaagcgttcgcggctgtcccagttgcgcgaaatggcgcgggac
tggccggccttccgcaccctgctctccaatatggagatggtgcttgccaagtccgatctc
gccatcgcgcagcgctacgccatgctggtgccccagcgcggcctgcgggaacgcatcttc
ggcgccatctcggacgaacatgcgcgcactctggccatgctcaagctcatcaaccagcgc
gagctcctggccgacaaccccgcgctggcggcctcgctgcgcgagcgcttcgcctatatc
gatcccttgaactatctgcagatcgatctcctgcgccgccaccgcgccagccagaaacgg
tccgacaccacgccggatccgcgcatcacgcccgccattcacctgaccatcaacggcatc
gcggcgggcttgcgcaactccggataa

DBGET integrated database retrieval system