KEGG   Bordetella pseudohinzii: BBN53_20330Help
Entry
BBN53_20330       CDS       T04945                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bpdz  Bordetella pseudohinzii
Pathway
bpdz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpdz01100  Metabolic pathways
bpdz01110  Biosynthesis of secondary metabolites
bpdz01130  Biosynthesis of antibiotics
bpdz01230  Biosynthesis of amino acids
Module
bpdz_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBN53_20330
Enzymes [BR:bpdz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BBN53_20330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 TsaE AAA AAA_16 Cytidylate_kin2 AAA_25 Zeta_toxin AAA_5 APS_kinase AAA_23 NB-ARC
Motif
Other DBs
NCBI-ProteinID: ANY18024
UniProt: A0A0J6BX70
LinkDB All DBs
Position
complement(4391385..4392020)
Genome map
AA seq 211 aa AA seqDB search
MNLSANLCAGADEEPPDPGAAPAAAAGESIEALAQLPHDLPIFLVGMMGAGKTTIGRGLA
RALGREFIDLDHELEARCGVRVPVIFEIEGEAGFRKRESAALQECTQRRGIILATGGGAV
LAEENRRFLRERGIVMYLRASVDELYRRTCRDRNRPLLATADPRGTLRDLMVKREPLYHE
VADLVIETGSTPIATLVKAILPKLQAYEKKL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaatctctccgctaacttgtgcgccggcgccgacgaagagccgcctgatccgggggcc
gctcccgcggccgccgccggcgaaagcatcgaagccctggcgcaattgccgcacgatttg
ccgattttcctggttggcatgatgggggcgggcaagaccaccatcgggcgcggcctggcg
cgggcgctgggccgtgagtttatcgatctggaccatgagctggaggcgcgttgcggcgtg
cgcgtgcccgtcattttcgagatagagggcgaggccggttttcgcaagcgggaatccgcc
gcattgcaagagtgtactcaacggcgggggataattctcgccaccgggggcggcgccgtg
ctggccgaggaaaaccgccgcttcctgcgcgaacgcggcatcgtcatgtatctgcgcgcc
agcgtcgacgaactctaccgccggacctgccgcgaccgcaatcgcccgttgctggccacc
gccgatccccgcggcacgctgcgcgacctgatggtcaagcgcgaaccgctctaccatgaa
gtggccgacctggtgatcgagaccggctccacgcccatcgccaccctggtcaaggccatc
ctgcccaagctgcaagcgtacgagaaaaagctatga

DBGET integrated database retrieval system