KEGG   Bordetella pertussis Tohama I: BP0102Help
Entry
BP0102            CDS       T00139                                 

Definition
(RefSeq) penicillin-binding protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00550  Peptidoglycan biosynthesis
bpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BP0102
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bpe01002]
    BP0102
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpe01011]
    BP0102
Enzymes [BR:bpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BP0102
Peptidases and inhibitors [BR:bpe01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BP0102
Peptidoglycan biosynthesis and degradation proteins [BR:bpe01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BP0102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-GeneID: 2665303
NCBI-ProteinID: NP_879005
UniProt: Q7W0L2
LinkDB All DBs
Position
100530..101786
Genome map
AA seq 418 aa AA seqDB search
MKTLPDTAIAPVVLSRRVLASAVLAAMLAAAAPAGAQQQAAPATPVAAAAPAAGGAVGAV
GDLAAVPVPTIAAKAWITVDVNSGQVLAASNADMKVEPASLTKIMTAYVVFNALQEKRLT
LEQQVPVSEHAWRTGGSRMFIEPRKPVTVDELNQGMIVQSGNDASVALAEAVGGSESAFA
ALMNQEAQRLGMRNTHFMNSTGLPDPQHVTTARDLATLAAHLISDYPDYYHYYKQKSYTY
NKITQPNRNRLLWADPSVDGMKTGHTDSAGYCLVSTAMRGDRRILTVLVGADSEATRAEE
SLKLLNWSFQNFDTVKLYDQSQPGLDARVWEGKVENVKLGPPNPVWLAVPRGKAAEIKPV
AQRTDPLVAPLTKGQQVGTLQLTLDGKTLRVEPLVVQEDVERAGFFGRMADTVKRWFQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttgcctgatactgctattgcccccgtcgttctttcccgtcgcgtattggcc
agcgccgtgctggctgccatgctggccgctgcggcgccggccggggcccagcagcaggcg
gcgcccgccacgcctgtcgccgccgccgcgcccgcggcgggcggcgcggtaggcgccgtg
ggagacctggcggccgtgccggtgccgaccatcgccgccaaggcgtggatcaccgtggac
gtcaacagcggccaggtgctggcagcctccaacgccgacatgaaggtcgagccggcctcg
ctgaccaagatcatgaccgcctatgtggtgttcaacgcgctgcaggaaaagcgcctgacc
ctggagcagcaggttccggtctccgagcacgcatggcgcaccggcggttcgcgcatgttc
atcgagccgcgcaagccggtgacggtcgacgaactgaaccagggcatgatcgtccagtcg
ggcaatgacgcatcggtcgcgctggccgaggccgtcggcggcagcgaaagcgcctttgcg
gccctgatgaaccaggaggcgcagcgcctgggcatgcgcaatacgcatttcatgaactcc
accggcctgcccgatccgcagcacgtcaccacggcgcgcgacctggccacgctggcggcg
cacctgatctcggattacccggactactaccactactacaagcagaaaagctacacgtac
aacaagatcacccagcccaaccgcaaccgcctgttgtgggccgatccgtcggtcgacggc
atgaagacggggcacaccgattcggccggctactgcctggtttcgaccgccatgcgcggc
gaccgccgtatcctgaccgtgctggtgggcgccgacagcgaagccacgcgcgccgaggaa
agcctcaagctgctcaactggagcttccagaacttcgatacggtcaagctgtacgaccag
agccagcccgggctggacgcgcgggtctgggaaggcaaggtcgagaacgtcaagctgggt
ccgcccaacccggtgtggctggcggtgccgcgcggcaaggcggccgagatcaagccggtc
gcgcagcgcaccgacccgctggtggcgccgctgaccaagggacagcaggtcggcacgctg
cagctcacgctcgacggcaagaccttgcgcgtcgaaccgctggtggtccaggaagacgtc
gagcgcgccggcttcttcggccgcatggccgacaccgtgaagcgctggttccagtaa

DBGET integrated database retrieval system