KEGG   Bordetella pertussis Tohama I: BP0655Help
Entry
BP0655            CDS       T00139                                 

Definition
(RefSeq) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00220  Arginine biosynthesis
bpe01100  Metabolic pathways
bpe01110  Biosynthesis of secondary metabolites
bpe01130  Biosynthesis of antibiotics
bpe01210  2-Oxocarboxylic acid metabolism
bpe01230  Biosynthesis of amino acids
Module
bpe_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BP0655
Enzymes [BR:bpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     BP0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42 Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 2667685
NCBI-ProteinID: NP_879492
UniProt: Q7VS04
LinkDB All DBs
Position
complement(663532..664704)
Genome map
AA seq 390 aa AA seqDB search
MSSATGDLLARLVAFPTVSRESNLALSSFVQDYLAQAGVASELFYNEAGTKANLFATIGL
RDRAGIVLSGHTDVVPVDGQPWTTDPFCLTEKDGRLHGRGTADMKGFIAAVLAAVPALVE
RPLRIPVHLAFSYDEELGCLGVGSMLAEIEKRAPLPSMCLIGEPTLLRPVLGHKGKAAMR
CQVKGHACHSAYAPSGVNAIEYAARLIGKLNEIGERLARPQHHDGRFDPPFSTVQTGTIA
GGRALNIVPAECEFDFEVRALPGFDPGLVQRELRTYADRELLPRMQAVNPETGIEMRPLS
AYPGLATEAHSEAARLLAQWCGSDDFGTAAYGSEGGLFSRSGIPTVICGPGSMDQGHKPD
EFVSLQQLAQCDAMLARLVAHVREPAAQTE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgccaccggcgacctgctggcgcgattggtcgcgttcccgaccgtcagccgc
gagtcgaacctggcgttgagctcgttcgtgcaggactacctcgcacaggccggcgtggcc
agcgaactgttctacaacgaagcgggcaccaaggccaatctgttcgccaccatcgggctg
cgcgaccgggccggcatcgtgctgtccggccacacggatgtcgtgccggtggacgggcag
ccgtggaccaccgatccgttctgcctcacggaaaaggacggacgtctccatggccgcggc
acggccgacatgaagggtttcatcgccgcggtgctggcggcggtgccggccctggtggaa
cgaccgctgcggattccggtccacctggcgttttcctatgacgaagaacttggctgcctg
ggcgtcgggtccatgctggccgagatcgaaaaacgcgcgccgctgccgtccatgtgcctg
atcggcgagccgacgctgctgcggcccgtcctcggccacaagggcaaggccgccatgcgt
tgccaggtaaagggacacgcgtgccattccgcatatgcgccttccggcgtcaacgccatc
gagtacgctgcccggctgatcggcaagctcaacgagatcggcgagcgcctggcaaggccg
cagcaccacgatggccgcttcgatccgccgttctcgacggtgcagaccgggaccatcgcc
ggcggacgcgcgctcaatatcgtcccggccgaatgcgaattcgacttcgaggtgcgggcc
ttgccgggcttcgaccccggcctcgtgcagcgcgaattgcgaacctatgcggaccgcgag
ctgttgccccgcatgcaggcggtcaatccggaaaccggcatcgagatgcggccgttgagc
gcctatccggggctggccaccgaggcgcacagcgaagcggcgcgcctgctggcgcaatgg
tgcggttcggacgatttcggcaccgcggcctatggctccgaaggggggctgttcagccgt
tcgggcatccccacggtgatatgcgggccgggcagcatggaccaggggcacaagcccgat
gagttcgtgtcgctgcaacagcttgcgcaatgcgacgcgatgctggcgcgcctggtcgcg
catgtgcgggagccggccgcgcaaacagagtaa

DBGET integrated database retrieval system