KEGG   Bordetella pertussis Tohama I: BP1221Help
Entry
BP1221            CDS       T00139                                 

Gene name
dadX
Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00473  D-Alanine metabolism
bpe01100  Metabolic pathways
bpe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BP1221 (dadX)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BP1221 (dadX)
Enzymes [BR:bpe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BP1221 (dadX)
Peptidoglycan biosynthesis and degradation proteins [BR:bpe01011]
 Precursor biosynthesis
  Racemase
   BP1221 (dadX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 2665336
NCBI-ProteinID: NP_879994
UniProt: Q7VYT6
LinkDB All DBs
Position
1283930..1285057
Genome map
AA seq 375 aa AA seqDB search
MPRPIFASISQSALRHNLATVRRHLDDVAAKADGTPPSIWAVIKANAYGHGIEQAVAGFS
AAQGLAMLDLQEAVRCREAGWGGPILLLEGFFQPSDLEIVDRYHLATTVHTREQFDMLAH
ARLSRRVDIMVKLNSGMNRLGFAPDAYGSAYARAQQLHEYGVVGGIGKMTHFACADGPQG
VTQQMNVFNGATAHLAGATSVCNSAATLRYADLAVGHDGQTHWVRPGICLYGASPFADAQ
AGAFGLIPAMTLRSELIAIQDIPAGAAVGYGAIFRADRPMRIGVVACGYADGYPRHAGTG
TPLTVGGVRTRLVGRVSMDMLMVDLDPVPAAGIGTPVVLWGEDGPSVDEVAEAAGTIGYE
LLCALAPRVPVRHEG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtcccatatttgcttcgatctcccagtccgccctgcggcacaaccttgccacc
gtgcgtcgtcatctcgatgacgtggcggccaaggcggacggcacgccgccctccatctgg
gcggtcatcaaggccaatgcctacggccatggcatcgaacaggcggtggccggtttctcg
gcggcccagggcctggccatgttggacctgcaggaggccgtgcgctgccgcgaagcgggc
tggggcggccctatcctgctgctcgaaggcttcttccagccgtccgacctggaaatcgtc
gaccgctatcatctcgccaccaccgtgcatacgcgcgagcagttcgacatgctggcgcat
gcgcggctgtcgcgccgcgtcgacatcatggtaaagctcaacagcggcatgaaccggctg
ggtttcgcgccggacgcctatgggtccgcctacgcgcgcgcgcagcagctgcatgagtac
ggcgtggtgggcggcatcggcaagatgacccatttcgcctgtgccgacgggccgcagggc
gtgacccagcagatgaacgtcttcaacggcgccaccgcgcacctggccggggcgaccagc
gtctgcaattcggccgccaccctgcgctatgccgacctggcggtcggccacgacggccag
acccattgggtgcggccgggcatctgcctgtacggcgcctcgccgttcgccgatgcccag
gccggggcgttcggattgattccggccatgacgctgcgctccgagctgatcgccatccag
gatatcccggccggcgcggcggtgggttacggcgccattttccgcgccgaccggccgatg
cgcatcggcgtggtggcgtgcggctatgccgacggctatccgcgccatgccggcaccggt
acgcccctgaccgtgggcggcgtgcgcacgcggctggtcggccgcgtgtcgatggacatg
ctcatggtcgacctggatccggtgccggccgccggtatcggcacgcccgtggtgctgtgg
ggcgaggacggcccgtcggtcgacgaagtggccgaggccgccggcaccatcggctacgaa
ttgctgtgcgcgctggccccgcgcgtacccgtgcgccacgaaggctga

DBGET integrated database retrieval system