KEGG   Bordetella pertussis Tohama I: BP1244Help
Entry
BP1244            CDS       T00139                                 

Definition
(RefSeq) 23S rRNA pseudouridylate synthase B
  KO
K06178  23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
bpe  Bordetella pertussis Tohama I
Brite
Enzymes [BR:bpe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     BP1244
Ribosome biogenesis [BR:bpe03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BP1244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-GeneID: 2666637
NCBI-ProteinID: NP_880016
UniProt: Q7VYR5
LinkDB All DBs
Position
1306706..1308472
Genome map
AA seq 588 aa AA seqDB search
MTTNTTMQDDNSFPDNESPVAQPPVDESAASGEAGDGEGGARARGRKLRTPFRRRRGDAA
AAGEAGADEAGSQPAAQSEGDARASERDADQALAYLDNAARIEQRLGKYLNSEAVMPKLH
KVLADAGIGSRREMEELIVAGRVSVNGEPAHIGQRVAPNDQVRVNGKPIARPNAKKPPRV
ILYHKPAGEIVSHDDPGGRASVFARLPKLRTGKWLSVGRLDLNTEGLLIFTTSGDMANRI
MHPRYGTEREYAVRVLGEMDDAQRKSLTEGIELEDGKAAFGSFEYLGGDGSNRWYRVTLQ
EGRNREVRRMFEAVGVTVSRLIRTRFGDIVLPRNLRRGRWEELDGSLVTALMVQLGLLRD
GDESEGRRKSRQPQSHDSALPPGFGTLERNGMNGARIGRRGKLQGGRPGSAAACPSDPFG
TGLMITGGYANGHPLGNDSAAGRGGKGKPAKGKAGGDKPQRGQGRKAAGAQAGGQGAAAK
PAGARGGKKAGGRAAAPGAKGAGGRAGGNKAASAGGKAAGVAKPASPTGNRGPAAPKPQR
ARRGGGGAGGGGGGGGGGGGRGDDWQPKGAGAHESRLGFMGGRGGRGR
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacgaatacaacgatgcaagacgacaattcctttcccgacaatgaatccccggtg
gcgcagccgcccgttgacgagtccgccgcatcaggcgaggccggcgacggcgagggcgga
gcccgggcgcgtggccgcaagctgcgcacgccgtttcgccgccgtcgcggcgacgcggcc
gccgctggcgaagccggcgccgacgaggcgggcagccagcccgccgcccagtccgagggc
gatgcccgcgccagcgagcgcgatgccgaccaggcgctggcctacctggacaacgcggcg
cgcatcgagcagcgcctgggcaagtacctgaacagcgaggcagtgatgcccaagctgcac
aaggtgctggccgatgccggaatcggttcgcgccgcgaaatggaagaactgatcgtggcc
ggccgggtgtcggtcaacggcgagccggcccacatcggccagcgcgtcgctcccaacgac
caggtgcgcgtcaacggcaagccgattgcgcgccccaacgccaagaagccgccgcgcgtc
atcctctatcacaagccggccggcgagatcgtcagccatgatgacccgggcggacgcgcc
agcgtgtttgccaggctgcccaagctgcgcaccggcaagtggctgtccgtggggcggctg
gacctcaataccgaggggctgctgatcttcacgacctccggcgacatggccaaccgcatc
atgcatccgcgctacggtaccgagcgcgaatacgcggtgcgcgtcctgggcgagatggac
gacgcgcagcgcaagtcgctcaccgagggtatcgagctggaggacggcaaggcggctttc
ggttctttcgaatacctggggggcgacggcagcaatcgctggtatcgcgtcaccttgcag
gaggggcgcaaccgcgaggtgcgccgcatgttcgaggcggtgggtgtgaccgtcagccgc
ctgatccgtacgcgtttcggcgatatcgtgttgccgcgcaacctgcgccgcggccgctgg
gaagagctcgacggttcgctggtgacggccctgatggttcagctgggcctgctgcgcgac
ggggacgagtccgaagggcggcgcaaatcgcgccagccccagtcgcatgacagcgcgctg
ccgccgggcttcggcacgctggagcgcaatggcatgaacggcgcccgtatcggccgtcgc
ggcaagctgcagggcggccgtcccggcagcgcggccgcgtgtccgtccgacccgttcgga
acgggcttgatgatcaccggcggttatgccaacggccacccgctgggcaacgacagcgcg
gcggggcggggcggcaagggcaagcctgccaagggcaaggcgggcggcgacaagccgcag
cgcggccagggccgcaaggcggcgggcgcgcaggctggcggccagggcgcggcggccaag
ccggcgggcgcgcgtggcggcaagaaggcgggcggccgcgcggcggcgcctggcgccaag
ggtgcgggtggccgcgccggcggcaacaaggcagccagcgcgggcggcaaggcggccggc
gtggccaagccggcctcgcccacgggcaatcgcggtccggccgcacccaagccgcaacgc
gcgcgtcgcggcggcggcggtgccggcggtggtggcggtggtggcggtggtggcggtggc
cggggcgacgactggcagcccaagggcgccggcgcccacgagtcccgtctcgggttcatg
ggcgggcggggcgggcgcggacgttga

DBGET integrated database retrieval system