KEGG   Bordetella pertussis Tohama I: BP2298Help
Entry
BP2298            CDS       T00139                                 

Definition
(RefSeq) 4-aminobutyrate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00250  Alanine, aspartate and glutamate metabolism
bpe00280  Valine, leucine and isoleucine degradation
bpe00410  beta-Alanine metabolism
bpe00640  Propanoate metabolism
bpe00650  Butanoate metabolism
bpe01100  Metabolic pathways
bpe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BP2298
   00650 Butanoate metabolism
    BP2298
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BP2298
   00280 Valine, leucine and isoleucine degradation
    BP2298
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BP2298
Enzymes [BR:bpe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BP2298
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BP2298
Amino acid related enzymes [BR:bpe01007]
 Aminotransferase (transaminase)
  Class III
   BP2298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 2666154
NCBI-ProteinID: NP_880936
UniProt: Q7VWF9
LinkDB All DBs
Position
2421591..2422865
Genome map
AA seq 424 aa AA seqDB search
MDNAELTRRKEAATPRGVGVMCNFYADRAENAELWDTEGRRYIDFAGGIAVLNTGHRHPQ
LMQALQAQMSRFTHTAYQIVPYASYIQLAERINQLAPGDFAKKTALFTTGAEAVENAVKI
ARTATGRPAVVAFGAAFHGRTLLGMALTGKVVPYKVGFGPFPADIYHVPYPNALHGVSTD
DALAALGTLFKTDVDPRRVAAIIIEPVQGEGGFNICPPAFMQALRALCDDHGILLIADEV
QTGFGRTGKLFAMEHYGVAADLTAMAKSLAGGMPLSAVCGRAEVMDAPPPGGLGGTYAGN
PLAVAAALEVIRIIETEDLLARGTRLGHQLRDHLEAQRHDAPEIAEVRALGAMVAVEFRQ
PGSDAPSPEFARQVQARALEQGLLLLTCGSDGNVIRFLFPLTIPEAVMREALDILARTLR
GQNA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgcagaactgacccgccgcaaggaggccgccacgccgcgcggcgtgggcgtg
atgtgcaacttctacgcggaccgcgccgagaacgccgaactgtgggataccgaaggccgc
cgctacatcgacttcgccggcggcatcgccgtgctcaacaccggccatcgccatccgcag
ctgatgcaggcgctgcaggcgcagatgagccgcttcacccacacggcctaccagatcgtc
ccgtacgccagctatatccagctggccgaacggatcaaccagctcgcgccgggcgatttc
gccaagaagaccgccctcttcaccacgggagccgaggcggtcgagaacgccgtcaagatc
gcccgcacggccaccggccggcccgccgtcgtcgccttcggcgcggcgttccacggccgc
acgctgctgggcatggccctgaccggcaaggtcgtgccgtacaaagtgggcttcggtccg
tttccggccgacatctaccatgtgccgtatccgaacgcgctgcacggggtatccaccgat
gacgcgctggcggccctgggcaccctgttcaagaccgacgtggacccgcgccgcgtggcg
gccatcatcatcgagccggtacagggcgagggcggtttcaatatctgcccgccggccttc
atgcaggcgctgcgcgccctgtgcgacgaccacggcatcctgctgatcgccgacgaagtc
cagaccggcttcggccgcaccggcaagctgttcgcgatggaacactacggcgtggcggcc
gacctgaccgccatggccaagagcctggccggcggcatgccgctgtcggcggtgtgcggc
cgcgccgaggtcatggacgcgccgccgccgggcggcctgggcggcacctatgccggcaat
ccgctggcggtggccgccgcgctggaggtgatccgcatcatcgagaccgaggacctgctg
gcgcgcggcacgcgcctgggccaccagttacgcgaccacctggaggcgcagcgccacgac
gcccccgagatagccgaggtgcgggcgctgggcgccatggtggcggtggagttccgccag
cccggcagcgatgcgcccagccccgaattcgcgcgccaggtccaggcccgcgcgctcgaa
caagggttgctgctgttgacctgcggcagcgacggcaacgtcatccgctttcttttcccg
ctgacgatcccggaggcggtcatgcgcgaagcgctggacatcctggcccggacgttgcgc
ggccagaacgcttga

DBGET integrated database retrieval system