KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110153179Help
Entry
110153179         CDS       T05002                                 

Gene name
hdac4
Definition
(RefSeq) histone deacetylase 4 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110153179 (hdac4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bpec03036]
    110153179 (hdac4)
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110153179 (hdac4)
Chromosome and associated proteins [BR:bpec03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     110153179 (hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 110153179
NCBI-ProteinID: XP_020772714
LinkDB All DBs
Position
Unknown
AA seq 1082 aa AA seqDB search
MTSHSHPGEGILGKEQPLDVLKTSALNHIPTVDINSALPLRLPPAAIPMDLRVEHPPQQV
SALSPPGQQAPGPQGSVLGPQGAPVLGPSLREQQLQQELLTLKQKQQIQRQILIAEFQRQ
HEQLSRQHEAQLHEHIKQQQELLALKHQQELLEHQRKMENHRLEQELEKQQREQKIQLLK
NKERGQESAVASTEVKMRLQEFVLNKKKALAQRSLNQGGLPNDAPYWYRKTQHSSLDQSS
PPQTGMSTFNHPVLGVYNPRDDFPLRKTASEPNLKLRSRLKQKVTERRSSPLLRRRDSPI
TTAKKRSLDMADSACSSAPGSGPSSPNNSSNNIPNENGITVSMSNSTEASLAQRLCNAER
GSISQLSLYTSPSLPNITLGLPATATATAASNVTSVQQEVGLQPALSLSPPFLTGGHLTP
YLEPGAGTGHGGHSPLLQHMVLMEQSPAQSPLVTGVSGLSMSPAASMAKLQRQHRPLART
QSAPLPQGSAQAHAQALALQQLVVQQQHQQFLEKHKQQFQQQQLHINKIMSKPSESPVGR
QHQSHPEETEEELREHQDLPPGVTIKQEPPDPQELQEEALQQHREQELIFRQQALLLEQQ
RIHQLRNYQASMEAAGLSMSFPGHRPLSRAQSSPASASSFPISVPAPEPPTKPRFTTGLV
YDSLMQKHQCMCGNTNSHPEHAGRIQSIWSRLQETGLRAQCECIRGRKATLEELQTVHSE
AHVLLYGTNPLRQKLDCSITPMFVRLPCGGVGVDSDTIWNEVHSSSAARLAVGSVVELVF
KVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVNKILIVDWDVHH
GNGTQQAFYDDPNVLYLSIHRYDDGNFFPGSGAPDEVGSGPGVGFNVNVAFTGGLDPPMG
DVEYLAAFRTVVMPIANEFAPDIVLVSSGFDAVEGHPPPLGGYTLTSKCFGYLTRQLMSL
AAGRVVLALEGGHDLTAICDASEACVAALLGQELDPLPKAVLEQRPNANAVRSLEKVVET
HSKYWRSVHRYSPRLGLSLLEAKRGDSEEAEAVSAMASLSVANSNAMDHRPEEEPMEEEE
PL
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacacagccatccaggagaggggatcctggggaaggagcagccgctggacgtt
ctgaagacatcagcgctcaaccacatcccaacagtggacataaactcagctctgcctctg
cgcctgcccccggctgctatccccatggacctgcgtgttgagcacccgccgcagcaggtg
tcagccctgtcgccgcccgggcagcaggccccagggccccagggttctgtgctcgggccc
cagggtgcccctgtgctggggccctcgctccgagagcagcagctgcagcaggagctgctc
accctcaagcagaagcagcagattcaaaggcagatcctcattgcagagtttcagaggcaa
cacgaacagctgtcccgccaacatgaggcccaactgcacgagcacatcaagcaacaacag
gaactactggctctgaagcatcaacaggaacttttggagcaccagaggaagatggagaac
cacaggctggagcaggaattggagaagcagcagagggagcagaagatccaactgctcaag
aacaaggagagggggcaagagagtgcggtggccagcacggaggtgaagatgcgtcttcaa
gagtttgtcctcaataagaagaaggctctggctcagcgcagtctcaaccaaggaggtctc
cctaacgacgccccctactggtaccgcaaaactcagcacagctccctggaccagagctcc
cctccacagactggcatgtccaccttcaaccaccctgtactgggggtctacaacccgagg
gacgacttccccctgagaaagaccgcctcggagcctaacctgaagctgcgctctcgactc
aaacagaaggtgacggagcgccggagcagccctctcctgcgccgccgtgacagtcccatc
accacggccaagaagcgctccctggacatggcagattcggcgtgtagcagtgcacccggg
tcaggtccaagctcccccaataacagctccaacaacatccctaatgagaacggcatcact
gtgtccatgtccaacagcactgaggcgtcgctggcccagaggctttgcaatgcagagcgt
ggttccatcagccaactgtccctctacacctcgccatctctacccaacatcaccctcgga
ctgccagcaaccgccacggccacggcagcctccaatgtgacttcagtccagcaggaggtg
gggctacagccggccctctccctcagccctcccttcctcacaggtggccacttgaccccc
tacctggagcctggtgctgggacagggcacggcgggcacagtcctctcctccaacacatg
gtgctgatggagcagagcccagcgcagagccccctggtgacaggtgtgagtggtctgtcc
atgtcgccggccgcctccatggccaaactgcagcggcaacaccggcccctggccaggacc
cagtccgcccctctgccccagggcagtgcccaagcccacgcccaggccttggccctgcag
cagctcgtggtgcagcagcagcaccagcaattcctcgagaagcacaagcagcagttccaa
cagcagcagctgcacatcaacaagatcatgtccaaacccagtgagtctccggtgggccgc
cagcaccagagccacccggaggagacggaggaggagctgagggagcatcaggacctgccg
ccaggggtcaccatcaaacaggaaccaccagacccccaggaactacaggaggaggcccta
caacagcaccgagagcaggagctcatcttcagacagcaggccctgttgttggagcagcag
cggatccaccagctgagaaactaccaggcgtccatggaggcggccggtctgtccatgtcg
ttccccggacacaggcccctctcgcgggcacagtcctctccggcttcagcctcctcattc
cccatcagcgtccctgctccagaaccccccaccaaaccacgcttcactacaggtctggtg
tacgactccctgatgcagaaacaccagtgcatgtgcggaaacaccaacagtcacccagag
cacgcagggcggatccagagtatatggtcccgactgcaagagacagggctcagagcacag
tgtgagtgtatccgagggaggaaggccactttggaggagctacagaccgtgcactcagaa
gcccatgtcctgctctacggtaccaaccctctccgacaaaaacttgattgttcaatcact
ccgatgttcgttcgactaccatgtggaggagtcggggtggacagtgacactatttggaat
gaggtccattcgtccagtgcagctcgtctggctgtgggctctgtggtggagctggtcttt
aaagtcgccactggagaactcaagaatggttttgctgtggttcgcccgcctggtcaccac
gctgaggaaagcactcccatgggcttctgctacttcaactcagtggccatcgccgccaaa
cttctgcagcaaagactcaacgtcaacaagatcctcatcgtagactgggatgttcaccat
ggcaacggcacccagcaggcattctatgacgaccccaatgtgctttacttatccatccat
cgctatgacgacggcaacttctttcctggcagtggcgctcctgatgaggtgggcagtggt
ccaggcgttgggtttaatgtcaacgttgccttcactggaggactggacccacccatggga
gatgtagagtacctggcagccttcaggacagtggtgatgcccatagccaacgagtttgcc
ccggacatcgtgctggtgtcgtctgggtttgacgcagtggaaggacatccccctcccctg
ggcggctacacgctcacgtccaaatgttttggctatctgacgcggcagctcatgagtctg
gctgcaggtcgcgtggtgttggctctggaggggggtcatgacctcaccgccatctgcgac
gcatctgaggcctgtgtggctgcgctgctgggacaagagctggaccctctgccaaaggct
gtgctggagcagaggcccaatgccaacgctgtccgctctttagagaaagtcgtggagacg
catagtaagtactggcgctctgtgcatcgctactccccacggctggggctgtctctactg
gaggccaaacgtggagactcagaggaggctgaggcggtcagtgccatggcctctctgtct
gtggccaactccaatgccatggaccacaggccggaggaggagcccatggaggaggaggaa
ccactgtaa

DBGET integrated database retrieval system