KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110153879Help
Entry
110153879         CDS       T05002                                 

Gene name
hdac8
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110153879 (hdac8)
Chromosome and associated proteins [BR:bpec03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     110153879 (hdac8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 110153879
NCBI-ProteinID: XP_020773465
LinkDB All DBs
Position
Unknown
AA seq 378 aa AA seqDB search
MSCRENSDDDSSSKRKVCYVYSPEYIERCDSLSKVPNRASMVHSLIEAYGLLQHMSIVKP
RVATTEEMAKFHSDSYLEHLHKISEDGDNDDPQSVDFGLGYDCPIVEGIYDYAAAVGGAS
ITAAQALLDGKCDVAINWAGGWHHAKKDEASGFCYVNDAVLGILKLREKYERVLYVDVDL
HHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDTGLGKGRWYAVNVPMEDGIQDDR
YYQVFTSVLQEVWSTFNPEAVVMQLGADTMAGDPMCSFNMTPVGVSKCLLYVLQWRLPTL
LLGGGGYNLANTARCWTFLTAAVLGKTLPSEIPDHEFFTEYGPDYSLEISPSCRPDRNDS
KHLDHVISTIKGNLKNVV
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcagagaaaacagtgacgatgacagctccagtaaacgcaaagtgtgttacgtt
tatagtccggaatatatcgaaagatgcgatagtttatccaaagtaccaaaccgggcgagt
atggtccactccctgatagaggcgtatggtctgctgcaacacatgagtattgtgaaacct
cgagtggcgacaacagaagaaatggcaaagttccacagtgactcgtacttagaacatctt
cataaaatcagcgaagacggagacaatgatgacccccagtctgtagacttcggactggga
tacgactgccccattgtggagggcatctatgactatgccgcagcagtaggtggcgcctcc
atcaccgcggctcaggcgctgcttgacgggaagtgtgacgtggccattaattgggctggg
ggctggcaccatgcaaagaaggatgaagcttctggtttctgttatgtgaacgatgcagtt
ttaggaatcctcaaactgagagagaaatacgagcgtgtgctttatgtggacgtggactta
caccatggagatggtgtggaagacgcctttagcttcacatccaaagtcatgaccgtttct
ctacacaagttttcacctggattcttccctgggacaggagatgtgagtgatacaggtctg
ggtaaaggccgatggtacgccgtcaatgtcccaatggaggacggtatccaagacgaccgc
tactaccaagtcttcaccagtgtcctgcaggaggtgtggtcgacctttaaccccgaggcc
gtggtgatgcagctgggggcagacacgatggcgggggaccccatgtgctcctttaacatg
accccagtgggtgtgtccaagtgcctgctgtacgtgctgcagtggaggctccccaccctg
ctgctgggaggaggggggtataacctggccaatacggcacgctgttggacgttcctcacg
gctgcagttttgggaaagactctcccatctgagatcccagaccacgagttcttcacagag
tatgggcctgactactcgctggagatcagtccaagctgtagaccggaccgcaacgactcc
aaacatctggatcacgtcatctccaccatcaaagggaatctgaagaatgtggtgtag

DBGET integrated database retrieval system