KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110153979Help
Entry
110153979         CDS       T05002                                 

Gene name
gck
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00010  Glycolysis / Gluconeogenesis
bpec00052  Galactose metabolism
bpec00500  Starch and sucrose metabolism
bpec00520  Amino sugar and nucleotide sugar metabolism
bpec00524  Neomycin, kanamycin and gentamicin biosynthesis
bpec01100  Metabolic pathways
bpec01200  Carbon metabolism
bpec04910  Insulin signaling pathway
Module
bpec_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bpec_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110153979 (gck)
   00052 Galactose metabolism
    110153979 (gck)
   00500 Starch and sucrose metabolism
    110153979 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    110153979 (gck)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110153979 (gck)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110153979 (gck)
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     110153979 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF1153
Motif
Other DBs
NCBI-GeneID: 110153979
NCBI-ProteinID: XP_020773575
LinkDB All DBs
Position
Unknown
AA seq 500 aa AA seqDB search
MPCVTATLNQMAENGTQYNSAIIERVLTIEEILSKFKLNKEELEEVMNRMQREMERGLRI
ETHEEASVKMLPTYVCSTPEGSEVGDFLALDLGGTNFRVMLVKVGEDEERSWKIETKNQM
YSIPEDAMTGTAEMLFDYIAECMSDFLGKHHIKHKKLPLGFTFSFPVRHEDLDKGILLNW
TKGFKASGAEGNNVVGLLRDAIKRRGEFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVG
TGCNACYMEEMRTVELVEGEEGRMCVNTEWGAFGDNGELEEFRLEYDRVVDAASINPGQQ
LYEKLISGKYMGELVRLVLMKLVNENLLFNGEASELLKTRGSFETRYVSQVESDSGDRKQ
IYNILSSLGVLPSELDCDIVRLVCEVISTRSSHLCAAGLAAVINRMRERRCLDTMNITVG
IDGSVYKLHPYFRDRFHKVVRELTLNCEISFLQSEEGSGRGAALISAVASKMAQITKVRY
KNPPSSFSSIWSLPIITSTW
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgtgtcactgctactcttaatcaaatggcagaaaatggcactcagtacaactca
gctatcattgaaagagttcttactatagaggaaattttgtccaaattcaagctgaacaaa
gaagaacttgaagaggtgatgaatagaatgcagcgggagatggaaagaggtctccgcata
gaaacccatgaagaggccagcgtcaaaatgcttcccacctacgtctgctccaccccagaa
ggatcagaggttggcgatttcttggctctagacctgggaggtacaaacttccgtgtcatg
ctggttaaagtaggggaggatgaagagaggagttggaaaattgaaactaaaaaccagatg
tactccatcccagaagatgccatgactgggacagcagaaatgttatttgactacatagca
gagtgcatgtcagactttttgggcaaacaccacatcaagcacaaaaagcttcctctgggg
tttaccttctcctttccagtaaggcacgaggatctggacaagggcatcctgctcaactgg
acaaagggcttcaaagcatctggcgctgagggaaacaatgtagtgggcttgctcagggat
gccatcaagagacgtggggaatttgaaatggatgttgttgccatggtgaatgacactgtg
gccaccatgatctcctgctactatgaagatcgtagctgtgaagttggtatgattgttggc
actgggtgtaatgcctgctatatggaggagatgaggaccgtggagttggtggagggggag
gaggggcgcatgtgcgtaaatactgagtggggggcatttggcgacaatggcgagttggag
gagttcagacttgagtacgacagagtggtggatgcggcctccattaaccccggacagcaa
ctgtatgagaagctcatcagtggcaagtatatgggggagttggtcagacttgtgctgatg
aagttggtgaatgaaaacctgctgtttaacggtgaagcatcggagctactgaagacacga
gggagcttcgagactcgctatgtctcacaggttgaaagtgactctggagacaggaagcag
atctacaacatcctgtcatctctgggggtgctgccctcagagttggactgtgacattgtg
cgtttggtttgtgaggtcatctccacccgctcctcccacttgtgcgcagcaggtctggcg
gctgtcatcaaccgtatgagagagcgccgctgcctggacacaatgaacatcactgtgggc
attgatggctctgtctacaagctccacccctatttccgtgataggttccataaagtagtg
cgagagctgacgctgaactgtgaaatctctttcctccagtctgaggagggcagtggccga
ggggcagcgctcatctctgcagtggccagtaagatggcccagataacaaaagtgagatat
aaaaacccacccagtagttttagctcaatttggagtctacctataatcacatcaacatgg
taa

DBGET integrated database retrieval system