KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110154688
Entry
110154688         CDS       T05002                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
bpec04020  Calcium signaling pathway
bpec04144  Endocytosis
bpec04510  Focal adhesion
bpec04540  Gap junction
bpec04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110154688 (pdgfra)
   04020 Calcium signaling pathway
    110154688 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110154688 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110154688 (pdgfra)
   04540 Gap junction
    110154688 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110154688 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpec01001]
    110154688 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bpec04090]
    110154688 (pdgfra)
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110154688 (pdgfra)
Protein kinases [BR:bpec01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110154688 (pdgfra)
CD molecules [BR:bpec04090]
 Proteins
  110154688 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Receptor_2B4 Herpes_gE Ig_6
Other DBs
NCBI-GeneID: 110154688
NCBI-ProteinID: XP_020774361
LinkDB
Position
Unknown
AA seq 1460 aa
MDVLKPCAVLVTLISLTCGLSPPTIISNEEEFILQPNSMFNISCTGKKSVVWAEPLPDNA
YVLPGFYTSTLFIDNATVENTGYYMCTYETFEGEPEENETGIYVFVPDPLTPFVPESLEN
LIVPMDHIGVSISCRVSDPQYHVVLKSVVSGEERSILYDNKIGFFGTLSPGRYYCETTVN
GRTFQSAIYTVEDEDTAVLDDLKLEVKASDETLTVGQALDITCTVQGGPFLQQQWLHPKK
QAVDAVQKKDVFSEHVIYTLHISKASAQDSGTYECSVTDQITGEVKTGTVAVIVFGNSYV
GLDHSGILSTEFVSLLEETEFTILIDAYPAPKVLWQKDDKDIEQNYYVLTTTSHFEGNRY
QSILKLRQPLEKDNGKYTIIATSGSRSAHFSFDLKVKVMFPPSSAPVLLPPNEEMVVPLH
SPFTLTCRGNGRIVWNTPLVVPEQTQEDSNGLFVNTVTVDNATAMHTGYYSCYYSSNSTD
SMDDSAIYVYVPDPEVPFIPSLLSFSNHVLSGPDEMVVQCRVSDPSANVTLVNVDLQQPV
PCVYDSKRGALGIFPGGTYVCKALINGQEYLSEEYIVHGWIGATVGSALHVELSARRTAL
LVGETINVTCLAKGSQVLEDHWKYPGKLANRGFKTVKEDQRNQEILYTLSIPHASTKDSG
IYTCSITDVMSNDSQTKTLTVTVYEREFLDIKPEFSAFETAELDEVREFRAEISALSSPR
VTWLKEGLPLGDVTAEISTSLRQIGETRYLSVLTLIRAKEEDSGNYTMNVTSGNQSRGLS
FTLQVKVPAVIVDLMDIHHGSASGQAVVCIARGQPTPEVEWFVCKNIKNCANDTSAWVPL
PANSTDVTMDAHMDEENNLESQVLFGHLENTLAVRCLAKNDMAAVSREVKLVSNGPHPEL
TVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYDSR
WEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSEL
KIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRESFLSLNTEKTKKEL
DIFGINPADESSRSYVILSFESKGDYMDMKQADSTQYVPMLEMSNSSKYSDILTSNYDHP
PSQKSSTGESEIDILLTDDLNEGLTTTDLLSFTYQVAKGMEFLASKNCVHRDLAARNVLL
SQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNMYTTLSDVWSYGILLW
EIFSLGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPHDVYEVMMKCWNSEPEKRPSFLGL
SETVATLLPSSYKRHYERVNHEFLKSDHPAVTRVCTESDDYIGITYKNQGKLKDRESGFD
EQRLSSDSGYIIPLPDLDPISDDDYGKRNRHSSQTSEESAIETGSSSSTLPKREGETLED
ITLLDEMCLDCSDLVEDSFL
NT seq 4383 nt   +upstreamnt  +downstreamnt
atggatgtgctaaagccgtgcgctgtgttggtgactcttatctcacttacctgcggcttg
tcaccacccactatcatttccaacgaagaggaatttattctgcagccaaactccatgttc
aacattagctgtacggggaagaagagcgtggtttgggccgaacctttgcctgataacgcc
tatgttttaccgggattttacacttctacgctgttcattgacaatgccactgtggagaac
accggctactacatgtgcacgtacgagacttttgagggagagccagaggagaacgagacg
ggcatatacgtctttgtaccagatcccctaacaccctttgtcccagagtctctggaaaac
ctgattgtgcccatggatcatattggtgtgtccatttcctgtcgagtatctgaccctcag
taccacgtagtcctgaagagcgtggtcagcggagaggagcgctctattctttatgacaac
aaaatcggcttctttggcactttgtctcctggccgctactactgcgagaccactgtgaat
ggacggacctttcagagtgctatctacactgttgaggatgaagacactgcagttttggat
gacctcaagttagaagtgaaggccagtgatgagacactcactgtgggacaggctctggac
atcacctgcactgttcaaggtggacccttcttacagcagcagtggcttcaccccaagaaa
caggcggtggatgctgttcagaagaaagacgtcttttcagaacatgtcatctacacgcta
cacatctccaaagcctctgctcaggacagtggtacttatgagtgctccgttacggatcag
atcactggagaggtcaaaactgggaccgtggctgtcattgtattcggtaattcttacgtc
ggtctggaccatagcgggattttgtctacagagtttgtcagtctgttggaggagacagag
tttactatcctgattgatgcctacccagctcccaaagtcttatggcagaaagatgacaag
gacattgaacaaaactattatgtcctcactacaaccagtcactttgagggcaatcgctat
cagagcattctcaagcttcgccaacctctggagaaggacaacgggaagtacaccatcatc
gctaccagtggttcacgcagtgctcacttttcttttgacctcaaagttaaagtcatgttc
ccaccatcctccgctccggtattgctccccccaaatgaggagatggtggtgcccctacac
tcccccttcaccctcacctgtcggggcaatggcagaattgtctggaatacccccctggtc
gtccctgagcagacgcaggaagacagtaatggtctctttgtcaacactgttactgtggac
aacgccacagccatgcacacaggatactacagctgctactacagctccaacagcacggat
agcatggacgacagcgccatctatgtctatgtgccagatcctgaggtgcccttcatcccg
tccttgctgtcatttagtaaccacgttttgtccggccccgatgagatggtggtccagtgc
agagtgtccgaccccagcgctaatgtcactctggtgaatgtggacctgcagcaacccgtg
ccctgtgtgtacgacagcaagaggggcgcgctggggatctttcctggggggacatacgtg
tgtaaagctcttataaacggacaggagtacctaagtgaggagtacatcgtccatggctgg
attggtgctactgttggtagtgctttgcatgttgagctcagtgccagaaggacggccctg
ctggtgggggagaccatcaatgtgacctgcctggcaaaaggatcacaagttctggaggat
cattggaaatacccgggaaaactggccaaccgtggctttaagacagtgaaggaggaccag
aggaaccaggaaatcctgtacacactgagcattccccacgcctccacaaaagacagtggg
atctacacctgctccatcacagatgtcatgagcaacgacagccaaaccaagactctcact
gtcactgtttatgagagggagtttctggatattaagcctgaattctcagcatttgagaca
gcagagcttgatgaggtccgtgagttccgagctgaaatcagtgctttgtcaagccctcgc
gttacctggctcaaagaaggacttcctcttggcgatgttactgcggaaatctccacttcc
ctccggcagatcggcgagaccaggtatttgagtgtcctaaccctgatccgggccaaagag
gaggacagcgggaactacacaatgaacgtcacaagtggaaaccaaagtcgtgggcttagc
ttcactctgcaggtcaaagtgcctgctgttattgtggacctcatggacatccatcatggt
tcagcttctggtcaggctgtggtctgcatcgcccggggccaacccactcctgaagttgag
tggtttgtctgcaaaaacatcaaaaactgtgccaatgatacgtctgcttgggtgcctctc
cctgccaactccaccgatgttaccatggacgcacacatggatgaggagaataatcttgag
agccaggttttgttcggtcatctggaaaacactctggctgtccgctgtctggctaaaaat
gacatggccgctgtgagtcgggaggtcaagctggtgtctaatggccctcaccctgagctg
accgtagctgctgctgtgctggtgctgctggtcattgtcatcatctcactcattgtgttg
gttgtcatatggaaacagaaacccagatatgaaatccgctggcgggtgattgagtctgtg
agccccgatggccatgaatacatctatgtggaccctatgcagctgccctatgactcgaga
tgggagttccctcgagatagactggttctgggtcgtatactgggctctggagcatttggg
aaggtggtagagggcacagcctacggactcagccgctctcagcctgtcatgaaggtggca
gtgaaaatgctaaaacccacagcccgttctagtgagaaacaggctctcatgtccgaactg
aagatcatgacccatcttggaccacatctgaacattgtcaaccttcttggggcgtgcacc
aagtcaggccctatctacattatcactgagtactgcttctatggagatctggtcaactat
ctgcacaagaacagggagagcttcctgagtttaaacacagagaagaccaagaaggaactg
gacatctttggcatcaacccggcagacgagagcagcaggagctacgtgatcctttctttt
gagagtaaaggagattacatggacatgaagcaggctgatagcactcagtatgtcccgatg
ctggaaatgagcaactcctccaaatactctgacatcctgacctccaactatgaccacccc
ccctcccagaagtcctccactggggaaagcgagatcgacatcctgctcacagacgatttg
aacgaaggcctgaccaccacggatctgctgagcttcacgtatcaagtggccaaaggcatg
gagttcttggcatccaaaaattgtgtgcaccgagacctggctgctagaaatgtgctgctg
tcccagggcaagatagtgaagatctgtgactttggactggcacgggacatcatgcatgac
aacaactatgtgtccaaaggaagtaccttcctcccagtgaagtggatggccccagagagc
atctttgataatatgtacaccactctatctgatgtctggtcctacggtatcctgctctgg
gagatcttctctttagggggcactccatacccggggatggtggtggactccagcttctac
aacaagatcaagagcggatacaggatgtccaaaccagagcatgctcctcatgatgtgtat
gaagtgatgatgaaatgctggaacagtgaaccggagaagaggccatccttcctgggtctg
agtgaaactgttgctacactgctcccctccagctacaagagacattatgaaagagtgaac
catgagtttttgaagagcgaccatccagccgtgacccgcgtgtgcacagagagtgacgac
tatatcggcatcacatacaaaaaccagggcaaactcaaggaccgggaaagcggctttgat
gagcagcgcctgagctcagacagtggctacatcatccccctccccgacctcgaccccatt
tctgacgatgactacggcaagaggaacaggcacagttctcaaacatccgaagaaagcgcc
attgaaacaggctccagcagttcgactttacccaagcgagagggcgagactttggaggac
atcacgctattggacgaaatgtgtctagactgtagcgacctggtggaggacagcttcctg
tga

DBGET integrated database retrieval system