KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110154976Help
Entry
110154976         CDS       T05002                                 

Gene name
gng7
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
  KO
K04543  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110154976 (gng7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpec04147]
    110154976 (gng7)
   04031 GTP-binding proteins [BR:bpec04031]
    110154976 (gng7)
Exosome [BR:bpec04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110154976 (gng7)
  Exosomal proteins of other body fluids (saliva and urine)
   110154976 (gng7)
GTP-binding proteins [BR:bpec04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    110154976 (gng7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 110154976
NCBI-ProteinID: XP_020774686
LinkDB All DBs
Position
Unknown
AA seq 68 aa AA seqDB search
MSTTNNIAQARKLVEQLRIEAGFERIKVSKAAADLMSYCEQHARSDPLLVGVPTSENPFK
DKKPCIIL
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccactaacaatatcgcccaggcccgaaaactggtggaacagctaaggatcgag
gcagggtttgagcgcatcaaagtgtccaaagcggccgcagacctgatgagttactgtgag
cagcacgcccgtagtgaccctctcctcgtcggggtgcccacctctgaaaaccctttcaag
gacaagaagccctgcatcatcctatag

DBGET integrated database retrieval system