KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110155116
Entry
110155116         CDS       T05002                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
bpec04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110155116 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110155116 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bpec04052]
    110155116 (kitlg)
Cytokines and growth factors [BR:bpec04052]
 Growth factors
  Growth factors (RTK binding)
   110155116 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 110155116
NCBI-ProteinID: XP_020774834
LinkDB
Position
Unknown
AA seq 267 aa
MKKSKSWIRVCVQLLLFIVFGGQALEFHGNPVTDDILKLNILRQNIPKDYKIPVRYIPKE
EGGMCWVKLNIFYLEESLRDLSHKFGNISTNRKDISIIIQMLEGSRIKMGQLDYIMFDFQ
CHYREERWATARYFDYVKDFLTETQQLKEFVDDCDPPPCPTTQLPTTTTTTVTQLGSTES
VSNVCPQRNCQPEKLWSEVLERSLLSLLFIPLLAIIFLLIWKLRSRRSLEDRDQARAEDG
LFSGAEGGAAPLDANVSETNQLTVETV
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaagttggatacgtgtctgtgtccagttactgctgttcatcgtgttt
ggaggacaagcgctcgagttccacggcaacccagtgacggacgacatcctcaagctcaat
attctgagacaaaatattcctaaagattacaaaattccagtgcgttacattccaaaagaa
gaggggggcatgtgctgggtcaaactcaacatcttctatctggaggagagtttaagggac
ctgtcgcataagtttggaaacatttcaaccaatcgtaaagacattagcataatcatacaa
atgctcgaaggctcacggatcaagatgggccaactggactacatcatgtttgacttccag
tgtcactatagagaggagcggtgggccacggcgcgatacttcgattacgtcaaagatttt
ctgacagagactcaacagctcaaagagttcgtagacgactgtgaccctccgccttgccca
acgacacaactaccaaccaccaccaccaccacagtcacacagctaggttccacagagtcc
gtgagcaacgtgtgtccccagaggaactgtcaacctgaaaagctttggtctgaagtcctc
gaacgcagcctcctctctctactcttcatccctctgttagccatcatcttcctcctcata
tggaagctgcggtctcggaggagcttggaggatcgggaccaggctcgggctgaagatgga
ctcttctcgggagcagaagggggcgctgctccgctagacgccaacgtgtctgaaacaaac
cagctaaccgtggagacggtgtaa

DBGET integrated database retrieval system