KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110155417Help
Entry
110155417         CDS       T05002                                 

Definition
(RefSeq) ALK tyrosine kinase receptor-like
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpec01001]
    110155417
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bpec04090]
    110155417
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110155417
Protein kinases [BR:bpec01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   110155417
CD molecules [BR:bpec04090]
 Proteins
  110155417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase MAM Gly_rich Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 110155417
NCBI-ProteinID: XP_020775175
LinkDB All DBs
Position
Unknown
AA seq 1917 aa AA seqDB search
MSERPVGPRGRNTLNLKDLGLELEVLPVTYSHMASQNRFLFARCPEIWAALTSSSHALNH
FLEQSFSNPLASDLQGLTSSSHALNHFLEQSFSNPLASDLQGLSSCDFESMCQWTFSNHS
EQGDWFVVPAGEAEQSRVSRPRTDHSLGTAKGHFLQLRASPGQCKYYLTSPVLPFSSELC
TLHLALLNWAPGNFSLLITPMNSDPQPLLIHSVHSRGQWDELEAVIGWIDEPFQVTLLYT
SCQAEGNTVALDSLELRNCEEQPLSELSTACGESFQCDATESCVDSSRVCDFHTDCPFGE
DEGFICGALPLGSYCSFEQDDCGWSVSTQHSQWRRLSTDYLDIQELLGEVLLSTPGHFLF
LQVRDSSAASKVSVLSPWFPAPVSSSDCQMYFSLYLFGDFNGTLVVAVEESDTENSPLVW
ERNGPWTDDWDHVALQLTGIEHRFHMRVTAVWAPGSEADIALDLISLGAACFYTDINELG
PAVDLGDLLSPLPEPSASEVSLTTWFFTSCGASGPHGPTQAQCDTTYRNKNVNVTVGKDG
PLKGVQMWRVPATNRYQISAYGAAGGKGAKNHNKRNHGVFISAMFVLEKGDTLYILVGHQ
GEDACPGRNQLTQKICLGESSVIEDNLREGANAEWAGGGGGGGGATYIFKMEGGEMVPLL
IAAGGGGNAYLEDPESSLDQTPLEQFENSTSAPSSSGHTGAAGGGGGWRGDLSPHSQAGQ
SLLDGSVGGSACPLALSKLGWVTYGGFGGGGGACTAGGGGGGYRGGDAAITDEILADGQD
GISFIHPAGEIFLQPLAAMESHGECEIKVQPNCSHCQMQNCRRDEDTRQIICLCHDGEVL
ANDNVTCISSPVPQSHMSVSLILAVVASTVASGVALICAGVILMWYRRKSDLHAVRGRLQ
SPEYKLSKIRSSTIMTDYNPNYCFAGKASSLSELKEVPRKNITLLRALGHGAFGEVYEGQ
LLGMSADNSPMQVAIKTLPEICSEQDEMDFLMEALIMSKFSHENIVRCIGVSLNILPRFI
LLELMTGGDMKSFLRQHRPRSGHTSSLTMRELLRMARDIACGCRYLEENHFIHRDIAARN
CLLTCPGPDRVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFMEGIFTCKTDTWS
FGVLLWEILSLGYMPYPCKTNQEVLEFVTSGGRMDPPKGCPGPVYRIMTQCWQHCPEHRP
NFSTILERINYCTQDPDVINTPLPVEYGPAAEEDAVPRPSEQLPSNHTPLTSLSVSVTPT
PQQLAKPHFLLLADQPLQHEAPEVTPKGTWLHPETQNQPHSINHSSSGSQRLKNKTKNLW
NPTYGSWVLESIRGKKALVHTQSMPLSSGSSPPQSSTSECTDTACDGANSLHPGTSTVLS
HRLPGVASGTSKAGMDLAKLQSFPCGNVNYAYDEQSYESENLPLAKAEVPVVKASCALSV
SLGSGLGLRLHTSAKAPKLLLKRHASYGHEDVRRHTKADKPPRDRDSGFSLDIAARNCLL
TCPGPDRVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFMEGIFTCKTDTWSFGV
LLWEILSLGYMPYPCKTNQEVLEFVTSGGRMDPPKGCPGPVYRIMTQCWQHCPEHRPNFS
TILERINYCTQDPDVINTPLPVEYGPAAEEDAVPRPSEQLPSNHTPLTSLSVSVTPTPQQ
LAKPHFLLLADQPLQHEAPEVTPKGTWLHPETQNQPHSINHSSSGSQRLKNKTKNLWNPT
YGSWVLESIRGKKALVHTQSMPLSSGSSPPQSSTSECTDTACDGANSLHPGTSTVLSHRL
PGVASGTSKAGMDLAKLQSFPCGNVNYAYDEQSYESENLPLAKAEVPVVKASCALSVSLG
SGLGLRLHTSAKAPKLLLKRHASYGHEDVRRHTKADKPPRDRDSGFSLSEDLSVTPI
NT seq 5754 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagagacctgtaggacccaggggacgaaacacactcaacttgaaggatctgggt
ttggagttggaggttctcccggtgacctatagccacatggcatctcagaaccgcttcctg
tttgcaagatgtcctgagatctgggcagcattgaccagctcgagccatgccctgaaccat
ttcctggagcagtctttctctaaccctctggcctcagaccttcagggcttgaccagctcg
agccatgccctgaaccatttcctggagcagtctttctctaaccctctggcctcagacctt
cagggcttgtcctcctgtgatttcgaatccatgtgtcagtggacgttctccaatcacagt
gagcagggtgactggtttgtggtgcccgcgggtgaggccgagcagagcagagtgtccagg
cctcgcactgaccactccctgggcacagcaaagggacatttccttcaactgcgagcctct
ccaggccaatgcaagtactacctgaccagtccagtcctgcccttcagctcggagctctgc
accttgcacttagccctgttgaactgggccccaggaaacttcagcctcctgatcacaccc
atgaactcagacccccagcctctgctcatccactcagtccacagcagggggcagtgggac
gagctggaggctgtgattggctggattgatgagccattccaggtcactctgttgtacacg
tcctgccaggctgagggcaacactgtggctctggactctctggagctccgaaactgtgaa
gagcagcctctgtcagagctgagcactgcctgtggggagtccttccaatgtgatgccact
gagagctgtgtagactcgagccgtgtgtgtgacttccacactgactgtccatttggagag
gatgaaggcttcatctgcggagccctccccttgggctcttactgttcgtttgagcaggac
gactgtggctggtctgtgtccacgcagcactctcaatggaggcgattgtcaactgattat
ctggatatccaggagctactgggagaagttctgctctccacacctgggcacttcctgttt
ttacaggtcagagacagcagtgctgccagtaaagtgtccgtcctcagtccatggttccct
gctccagtctcctccagtgactgccagatgtacttttctctgtacctctttggggacttt
aatgggactctggtcgtggccgtagaagaaagtgatacagagaacagccctctggtgtgg
gagaggaatggcccgtggacagacgactgggaccatgttgctctgcagctgactgggatt
gagcacaggtttcacatgagggtgactgctgtgtgggctcctggctccgaggctgatatt
gccctagacctaatctctttgggagcagcctgcttctacactgatataaatgagctgggg
cctgcggtggacctgggggatcttctgagccctctccctgagccctcagcctcggaggtt
tccctgactacatggttctttacctcgtgcggggcgagtggtccacatgggcccactcag
gctcagtgtgacaccacctacaggaacaagaacgtcaatgtcactgtgggaaaggatggt
ccactgaaaggagtccagatgtggagggtcccagccacaaaccgataccagatctcagcg
tatggagccgcaggagggaaaggagccaaaaatcacaacaagcgcaaccatggggtcttt
atttcagcgatgtttgttctggagaagggagatacactgtacattttggtcggccaccag
ggagaagacgcatgtccagggagaaaccagctgacccagaagatttgtctgggggagtct
tcagtgatagaagacaacctgagggaaggggcaaatgctgagtgggccggaggtggagga
ggagggggtggtgccacatacatctttaagatggaggggggtgagatggtgcctctgctt
atcgcggctgggggaggcggaaatgcatacctggaggacccagagtccagtctggatcaa
acccctctggagcagtttgagaacagcaccagtgcccccagcagcagtgggcacacagga
gcagcaggtggaggtgggggctggagaggtgacctgagtcctcactcccaagcgggacag
tctctcctagatgggtctgtcggggggtctgcctgtccattggctctgtctaaactcggc
tgggtaacctacgggggctttggaggtggagggggcgcatgcaccgcaggaggaggtgga
ggtggctacagaggaggagatgctgctataactgatgagatcttggctgacggccaagac
ggaatctctttcattcaccccgcaggagagatcttcctgcagccgttggcagccatggag
agccatggggagtgtgagatcaaagtacaacccaactgtagtcactgtcagatgcagaac
tgcagacgggatgaggacacgcgtcagattatctgtctgtgccacgacggggaggtcctg
gccaatgacaacgtcacctgcatcagtagccctgtccctcagagtcacatgtcagtgtct
ctgatcctggcagtggtggcctctactgtggccagtggtgtcgctctcatctgtgctggt
gtcatcctcatgtggtaccgcaggaaaagtgacctgcatgctgtcagaggacggctgcag
agtccagagtacaagctcagtaaaattcgctcctccaccataatgacagactacaatcca
aactactgttttgctggtaaagccagctcactcagtgaactgaaggaagttccccggaaa
aacatcactctccttagggctcttggccatggagcgtttggagaagtgtacgagggacag
ctcctggggatgagtgctgataatagtcccatgcaggttgctataaagacccttcctgag
atttgctcagaacaagacgagatggacttcctgatggaggctctgatcatgagtaagttt
agtcatgaaaacattgttcgctgcattggagtgagtctcaacatcctgccacgcttcatc
ctcctggagctgatgacaggtggagacatgaagagctttctgaggcagcacaggcccaga
tctggccacacctcatccctcaccatgagggagctgctgcgcatggcccgggacatcgcc
tgtggctgtagatacctggaggagaaccacttcattcacagagacattgctgctcgaaac
tgtctgctcacatgtccaggacctgaccgagtggcaaagataggagactttggtatggcc
cgagacatttacagggccagctactacaggaaaggaggcagagccatgctgcctgtcaaa
tggatgccccctgaggcttttatggagggaatttttacctgcaaaactgatacatggtca
ttcggagtattgctctgggagattctttctctaggatacatgccttatccctgtaaaacc
aaccaggaggttctggagtttgtcaccagtggaggccgtatggatcccccaaaagggtgc
cccgggcctgtttaccggatcatgacccagtgctggcagcactgtccagaacacagacct
aacttttctacaattctggagagaatcaactactgcactcaggacccagatgtgatcaac
actcctcttccagtggagtatggccctgctgcagaggaggatgcagtcccacgcccctct
gagcagctcccttccaaccacacacctctgacatcgctgagtgtctctgtcactcctact
ccacaacagcttgctaaaccacactttctccttcttgccgaccaaccccttcaacatgag
gccccagaggtgacccccaaggggacctggctccaccctgagactcagaatcaaccacac
tctataaatcattcctcatcaggaagtcaaagacttaagaacaaaaccaagaacttgtgg
aaccccacgtatggctcctgggttctggagagcatcaggggtaagaaagccctggtccac
actcagtccatgcctctgtcctcaggcagcagccctccacagagctccacctctgaatgc
actgacacagcctgtgatggagccaacagccttcaccctgggacatccacagtactctcc
catagactccctggggtggcctctggcacttccaaggctgggatggacctggctaagctt
cagagcttcccctgtggcaatgtcaactatgcatatgatgagcagagctatgagtcagag
aacctgcctttggcaaaggctgaagtcccagtggtaaaggccagctgtgctctgagtgtg
tctttgggaagtggcttaggactgcggctccacacctcagccaaagcacccaaactgctc
ctgaagaggcacgccagctatggacacgaggatgtgaggagacacaccaaagctgataaa
cctccccgtgaccgtgactcaggattctctctagacattgctgctcgaaactgtctgctc
acatgtccaggacctgaccgagtggcaaagataggagactttggtatggcccgagacatt
tacagggccagctactacaggaaaggaggcagagccatgctgcctgtcaaatggatgccc
cctgaggcttttatggagggaatttttacctgcaaaactgatacatggtcattcggagta
ttgctctgggagattctttctctaggatacatgccttatccctgtaaaaccaaccaggag
gttctggagtttgtcaccagtggaggccgtatggatcccccaaaagggtgccccgggcct
gtttaccggatcatgacccagtgctggcagcactgtccagaacacagacctaacttttct
acaattctggagagaatcaactactgcactcaggacccagatgtgatcaacactcctctt
ccagtggagtatggccctgctgcagaggaggatgcagtcccacgcccctctgagcagctc
ccttccaaccacacacctctgacatcgctgagtgtctctgtcactcctactccacaacag
cttgctaaaccacactttctccttcttgccgaccaaccccttcaacatgaggccccagag
gtgacccccaaggggacctggctccaccctgagactcagaatcaaccacactctataaat
cattcctcatcaggaagtcaaagacttaagaacaaaaccaagaacttgtggaaccccacg
tatggctcctgggttctggagagcatcaggggtaagaaagccctggtccacactcagtcc
atgcctctgtcctcaggcagcagccctccacagagctccacctctgaatgcactgacaca
gcctgtgatggagccaacagccttcaccctgggacatccacagtactctcccatagactc
cctggggtggcctctggcacttccaaggctgggatggacctggctaagcttcagagcttc
ccctgtggcaatgtcaactatgcatatgatgagcagagctatgagtcagagaacctgcct
ttggcaaaggctgaagtcccagtggtaaaggccagctgtgctctgagtgtgtctttggga
agtggcttaggactgcggctccacacctcagccaaagcacccaaactgctcctgaagagg
cacgccagctatggacacgaggatgtgaggagacacaccaaagctgataaacctccccgt
gaccgtgactcaggattctctctgtctgaagacctcagcgtaaccccaatctaa

DBGET integrated database retrieval system