KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110155487Help
Entry
110155487         CDS       T05002                                 

Definition
(RefSeq) probable histone deacetylase 1-B
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04110  Cell cycle
bpec04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    110155487
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    110155487
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110155487
Chromosome and associated proteins [BR:bpec03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     110155487
   HDAC complexes
    Sin3A-HDAC complex
     110155487
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    110155487
  Chromatin remodeling factors
   NuRD complex
    110155487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 110155487
NCBI-ProteinID: XP_020775252
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MALTSQGTKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
SGEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSGGGSVA
GAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEA
IFKPIMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYMKSFNLPLLMLG
GGGYTIRNVARCWTYETAVALDASIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYL
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDEEEEDPNKRISIRAHDKRIACEEE
FSDSEDEGEGGRRNVASYKKPKRPKTEGEKEGEEKEKKGQEETEEVKEEEKEPEDEKMDT
SKPKEESKTP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttacttcgcaaggaacaaagaaaaaagtttgctactattatgatggagacgta
ggaaattactactatggacagggacatcccatgaaacctcaccgaatccgtatgacccac
aacctgttactcaactatggcctgtacaggaagatggaaatctatcgtccgcacaaagcc
agtggagaagagatgacaaagtatcacagcgatgactacataaaatttctgcgttctatt
cgtccagacaacatgtcagagtacagcaagcaaatgcagagatttaatgtgggtgaagat
tgtccagtctttgatggattgtttgagttctgtcagctctcaggaggaggctccgttgct
ggtgctgtaaaactgaataagcagcaaacagacatcgccatcaactgggctggaggtcta
catcatgcaaagaagtctgaagcctctgggttctgctacgtcaatgacattgtccttgcc
atcttagagttactgaaatatcatcagagagttctgtacattgatattgatattcaccat
ggtgatggcgtggaggaagccttctacacaacagaccgtgtcatgactgtgtcctttcac
aaatatggagagtattttcctggcacaggtgacctcagggacattggtgctggtaaggga
aaatattatgctgtgaattacccactgagggatggcattgatgatgagtcctatgaagcc
attttcaaaccaatcatggccaaggtgatggagatgtaccagcccagtgcagtggtcctg
caatgtggagcagactctttgtcaggagacagacttggctgcttcaaccttacaattaaa
ggtcatgccaagtgtgtggagtacatgaaaagctttaacctcccattgctaatgctgggt
ggaggaggttacactattcgaaatgtggcacgctgttggacgtatgagaccgcagtggca
cttgatgcttctatccctaatgagctcccgtacaatgattactttgaatactttgggcct
gacttcaagctgcacattagcccctccaacatgacaaaccaaaatacaaatgattacttg
gagaagataaagcagcgtttattcgagaacttacgcatgctcccacacgcccctggagta
cagatgcaggccattccagaagatgctgtacaggaagacagtggagatgaggaagaagag
gatcccaacaaacgcatatcaatccgtgcccatgataagaggatagcatgtgaagaggaa
ttctctgactctgaagatgagggtgaaggaggacgcagaaatgttgcaagctacaagaaa
cccaagcgaccaaaaactgaaggcgagaaagagggggaagaaaaggagaaaaaagggcag
gaagaaacagaagaagtcaaagaagaagagaaggagccagaggacgagaaaatggacact
tcaaagcccaaagaggagtcaaaaacaccttga

DBGET integrated database retrieval system