KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110155742Help
Entry
110155742         CDS       T05002                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00010  Glycolysis / Gluconeogenesis
bpec00030  Pentose phosphate pathway
bpec00051  Fructose and mannose metabolism
bpec00052  Galactose metabolism
bpec01100  Metabolic pathways
bpec01200  Carbon metabolism
bpec01230  Biosynthesis of amino acids
bpec03018  RNA degradation
Module
bpec_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110155742
   00030 Pentose phosphate pathway
    110155742
   00051 Fructose and mannose metabolism
    110155742
   00052 Galactose metabolism
    110155742
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    110155742
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bpec01009]
    110155742
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bpec03019]
    110155742
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     110155742
Protein phosphatases and associated proteins [BR:bpec01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110155742
Messenger RNA biogenesis [BR:bpec03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     110155742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 110155742
NCBI-ProteinID: XP_020775559
LinkDB All DBs
Position
Unknown
AA seq 793 aa AA seqDB search
MANNAPPKRQDTRKFFENLSGDGKSIGVLTSGGDAQGMNAAVRAAVRMGLYVGAKMYFIH
EGYQGMVDGGDNIQEASWESVSSMLQVGGTVIGSARCKEFRTHEGRLRAALNLVQRQITN
LCVIGGDGSLTGANLFREEWSGLLGELRDQGLIDQSAVDSNSVLHIVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPE
MPPEDGWEDSLCQKLSENRVDKKRLNIIIVAEGAIDRHSKNITAENIKDLVVSRLGFDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVLALLEASSDTPACVVSLVGNQAVRLPLMECV
QMTQKVQKAMDEKKFEEAVQLRGRSFENNLTTYRLLSSRKADSELPTSNFNVAVLNVGAP
AAGMNAAVRSAVRVGITEGHKMFAVSDGFEGLYKGQIKEITWGDVGGWTGQGGSLLGTKR
TLPGKHLPEIAEQMKRHNINALLVIGGFEAFESLLQLYAARAQYQELCVPMCMLPFTISS
NIPGTDLCLGSDTALNAIVQTCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGAD
SVYIYEEPFDIRDLQANVEHLTEKMKTSIQRGIVLRNENCNGNFTTDFMYQLYSEEGKGV
FDCRKNILGHMQQGGAPSPFDRNFSTKIAAKAMQWITRSLHESYKGGRVFANSEDTACLL
GMRRRALVFQPLSHLQEETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHLA
RVRPKDTHTSAAI
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggccaacaacgcccccccgaagcgccaggacaccaggaaatttttcgagaatctgtcc
ggagatggaaaatccatcggggtgctcaccagcggaggagatgcccaagggatgaacgcg
gcggtccgggctgccgtccgtatggggctgtacgtcggagccaaaatgtatttcatccac
gagggttaccaggggatggtggacggaggagacaacatccaagaggcgtcgtgggaaagt
gtctccagcatgttacaagtgggggggacggtgatcggcagcgcgcgttgtaaagagttc
cgcactcacgaaggacgactccgcgcggcgctgaacctcgtccagagacaaatcacaaac
ctgtgcgtgatcggaggagacgggagtctgaccggagccaacctgttcagagaagagtgg
agcggactgctgggcgagctccgggaccaaggtctgatcgatcagtcggccgtggacagt
aactccgttcttcacatcgtggggatggtgggttccatagacaatgacttctgcggcacc
gacatgaccatcggcaccgactccgccctgcaccgaatcatcgaggtggtggacgccatc
atgaccacggcccagagtcaccagagaacctttgtgctggaggtgatgggacgtcactgc
gggtatctggccctggtcagcgctctggcctgtggggcagactgggtgtttatccctgag
atgcctcctgaggacggctgggaggacagtctgtgccagaaactctctgagaatcgtgtg
gataaaaagcgtctgaacatcatcatcgtggctgaaggcgccatcgaccgccacagcaaa
aacatcaccgccgaaaacatcaaggacctggtggtgagtcgtctgggcttcgacaccaga
gtgaccatcctgggccacgttcagagaggaggaaccccgtctgccttcgaccgcatcctg
gcgagccgtatgggcgtggaggccgttctggctctcctggaggcgtcctcagacacaccc
gcctgtgtggtgtctctcgtggggaaccaggccgtcagactccccctcatggagtgtgtg
cagatgactcagaaggtgcagaaggccatggacgagaagaagtttgaggaggccgtccaa
ctccggggaaggagttttgagaataacctgacgacctacaggctgctgtcgtctcgtaag
gccgactccgaactcccaactagtaactttaacgtggcggtgctgaacgtgggcgcacct
gccgccgggatgaacgcggcggtgcgctcggccgtcagggtcgggatcacggagggacac
aagatgtttgcagtgagcgacggcttcgagggcctctacaagggacagattaaagagatc
acctggggagacgtggggggctggaccggtcagggaggctctctgctcgggaccaagagg
actctgcctgggaaacacctgccggagatcgcggagcagatgaagcgtcacaacatcaac
gcgctgctcgtcatcggagggttcgaggcgtttgagtctctgctgcagttgtacgcggcg
cgggctcagtaccaggagctgtgtgtgcccatgtgcatgctccccttcaccatcagcagc
aacatccccgggaccgacctgtgcctgggctccgacaccgcgctcaacgccatcgtgcag
acgtgtgaccggatcaaacagtcggcgagcggaaccaagcgccgcgtcttcatcatcgag
accatgggcggctactgcggttacctggcaaccgtgggcgggctggcggccggcgccgac
tcggtttacatctacgaagaaccgtttgacatccgcgacctgcaggcgaacgtcgaacat
ctgacggagaagatgaagacgagtatccagagaggaatcgtgctcaggaatgaaaactgt
aatggaaacttcaccacagatttcatgtatcagttgtacagcgaagagggaaaaggcgtt
ttcgactgtcgcaagaacatcctgggacacatgcagcaggggggcgctccgtctccgttc
gacagaaacttcagcaccaaaatcgccgccaaggccatgcagtggatcacccgcagtctg
cacgagtcctacaagggaggtcgtgtgtttgcgaactcagaggacactgcgtgtttgttg
gggatgcgtcgcagagctctggtgtttcagcctctgtcccacctgcaggaagaaacagac
tttgttcatcgtatccctaaggagcagtggtggctgaagctccgccccctcatgaagatt
ttggccaaatacaaaacgagttacgacgtttccgactcgggtcaactggaacatctggcc
cgagtgcgccccaaggacacccacacgtctgccgccatctga

DBGET integrated database retrieval system