KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110155995Help
Entry
110155995         CDS       T05002                                 

Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00010  Glycolysis / Gluconeogenesis
bpec00051  Fructose and mannose metabolism
bpec00052  Galactose metabolism
bpec00500  Starch and sucrose metabolism
bpec00520  Amino sugar and nucleotide sugar metabolism
bpec00524  Neomycin, kanamycin and gentamicin biosynthesis
bpec01100  Metabolic pathways
bpec01200  Carbon metabolism
bpec04910  Insulin signaling pathway
Module
bpec_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bpec_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110155995
   00051 Fructose and mannose metabolism
    110155995
   00052 Galactose metabolism
    110155995
   00500 Starch and sucrose metabolism
    110155995
   00520 Amino sugar and nucleotide sugar metabolism
    110155995
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110155995
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110155995
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bpec04131]
    110155995
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110155995
Membrane trafficking [BR:bpec04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110155995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 110155995
NCBI-ProteinID: XP_020775831
LinkDB All DBs
Position
Unknown
AA seq 919 aa AA seqDB search
MIAAQLLAYYFTELKDDQLKKIDKYLYSMRFSDETLKDLMNRFRREMENGLSRDTNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVTQDKKQPVQMESQVYETPDDIIH
GSGTQLFDHVADCLGDFMEKQKIKDKKLPVGFTFSFPCAQTKLDEAVLLTWTKKFKSSGV
EGMDVVKLLNKAIKKRGDYQADIMAVVNDTTGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDNGSLEDIRTEFDREIDRGSVNPGKQLFEKMASGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGTIQTKHVSAIEKSKEGLKKCMQILTSLG
VEPSDEDCLAVQHVCTIVSFRSANLISATLGAILRRLKDNKGVARLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLTDQARQIQQTLAEFRLS
KAQLLEVKKRMRIEIERGLGKNTHKEATVKMLPTYVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVHCISDFLDYMGMKSARLPLGF
TFSFPCYQTSLDAGILVTWTKGFKATDCEGEDVVELLREAIKRKEEFELDVVAIVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNIEMVEGNEGRMCVNMEWGAFGDNGCLDD
IRTIYDQSVDENSLNEGKQRYEKMCSGMYLGEIVRQILIDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLDSTCDDSIIVKEVCGTVSRRAAQICGAGMAA
VVDKIRENRGLEHLDVTVGVDGTLYKLHPHFSRIFQQTVKELAPKCDVTFLLSEDGSGKG
AALITAVGCRQRELDAQQH
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgatagccgctcagcttctggcctactacttcactgagttgaaggatgatcagctcaaa
aagattgacaagtacctgtactcgatgcgtttctctgatgagacgctcaaggacctcatg
aaccgctttaggagggagatggagaacggactcagccgtgacacaaaccccaccgccacc
gtcaagatgctgcctaccttcgtccgctccatccctgatggatcagaaaagggagacttc
attgctctggacttaggtgggtcaaacttcaggatcctcagagtgaaagtgacacaggat
aaaaagcagccggttcagatggagagccaggtgtacgagactccagacgacatcatccac
ggcagcggcacacagctgttcgaccatgtggccgactgtctgggcgactttatggagaaa
cagaaaatcaaagacaagaagctcccagtgggtttcaccttctccttcccctgtgcccaa
accaaactggatgaggcagtgttattgacgtggacaaagaagtttaagtccagtggcgtt
gaaggaatggacgtggtaaagctgctaaataaagccatcaagaagagaggggattaccag
gccgacatcatggctgtggtgaatgacactacaggcaccatgatgacctgtgggtttgac
gaccagcgttgtgaagtgggaattattataggtaccggtacaaatgcatgttatatggag
gagctgaggcacatagacctggtggagggggatgagggacgaatgtgcattaacacagag
tggggagcatttggggacaacggctccttagaagacatccgcacagagtttgaccgcgag
attgaccgaggctccgtcaacccgggaaaacaattgtttgagaagatggccagtgggatg
tacatgggggaacttgtgcgcctgattctggtgaaaatggcaaaagagggacttctgttt
gagggacgcatcactcctgagctcctgaccaaaggcaccatccagaccaagcatgtctcc
gccatcgagaagtctaaggagggcctaaagaagtgcatgcagatcctgaccagtctggga
gtggagccttcggatgaggactgtctggccgtgcagcacgtttgcactatcgtgtccttc
aggtcggcaaatctcatctctgccactcttggcgccatccttcgccgcctcaaagacaac
aagggtgtagcccggctccgcactacggtcggcatcgacggatcactctacaagatgcac
ccacaatacgctcgtcggctgcataaaactgtgaggcgcctggtcccagactccgatgtg
cggttccttctctctgagagcgggagtggaaaaggtgctgccatggtaacagcagtggcc
taccgcctcacagatcaggcgcggcagattcagcagaccttggccgagttcaggctaagt
aaagcacagctgctggaggtgaagaagagaatgcggattgagatcgagagaggactgggc
aaaaacacgcacaaagaggctactgtcaaaatgctgcccacgtatgttaggagtacacca
gatggcacagaaaacggtgatttcctagccttggatctgggaggcacaaacttccgagtg
cttttggtgaagattcgcagcggcaaacggcgaacagtggagatgcacaacaaaatctat
gccattcccatagaagtcatgcagggcaccggagaagagctgtttgaccacattgtgcac
tgcatctcggacttcctggattacatggggatgaagagtgctcgtcttcctctgggcttc
accttctctttcccctgttatcagaccagcttggatgctgggattctggtaacatggacc
aaaggcttcaaagccacagactgtgaaggtgaagacgtggtggagctgctcagagaggcc
atcaagaggaaagaggagtttgagctggatgtagtggccatagtgaatgacacagtgggg
acaatgatgacttgtgcttatgaagagccaacatgtgaagtcggactcatcgcaggaacg
ggcagtaatgcgtgctacatggaggagatgagaaacattgagatggtggaggggaacgag
gggcggatgtgtgtgaacatggagtggggcgcgtttggggataatggctgtttggacgac
atccggaccatctacgatcagtccgtggatgagaactcacttaacgagggcaagcagaga
tatgagaagatgtgcagtggcatgtacctgggagagattgtcaggcagattctgatcgat
ttgaccaaacgaggattcttgttcagagggcagatctcagagacactcaagaccaggggc
atcttcgagaccaagttcctatcacagatcgagagtgaccgtctggccctgctccaggtg
agggcgatcctgcagcaattgggtctggacagtacgtgtgatgacagtatcatcgtgaag
gaggtgtgtggcaccgtgtctcgacgtgccgctcagatctgtggagccggaatggccgct
gtggtcgacaagatacgagaaaacagaggcctggagcacctggatgtgactgtgggagtg
gacgggacgctctacaaactgcacccacatttttcgcggatcttccaacagacggtgaag
gagttggcccccaaatgtgatgtgacgttcctgctttcagaggatgggagcgggaagggg
gcggctctgatcactgcagtgggctgtcgccagagagagcttgatgcacagcaacactga

DBGET integrated database retrieval system