KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110157017Help
Entry
110157017         CDS       T05002                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00562  Inositol phosphate metabolism
bpec01100  Metabolic pathways
bpec04068  FoxO signaling pathway
bpec04070  Phosphatidylinositol signaling system
bpec04115  p53 signaling pathway
bpec04140  Autophagy - animal
bpec04150  mTOR signaling pathway
bpec04218  Cellular senescence
bpec04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110157017
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110157017
   04070 Phosphatidylinositol signaling system
    110157017
   04150 mTOR signaling pathway
    110157017
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110157017
  09143 Cell growth and death
   04115 p53 signaling pathway
    110157017
   04218 Cellular senescence
    110157017
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110157017
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bpec01009]
    110157017
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110157017
    3.1.3.48  protein-tyrosine-phosphatase
     110157017
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     110157017
Protein phosphatases and associated proteins [BR:bpec01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    110157017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 110157017
NCBI-ProteinID: XP_020776917
LinkDB All DBs
Position
Unknown
AA seq 462 aa AA seqDB search
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFVEAQEALDFYGEVRTRDKKGVTIPSQRRYVHYYNY
LLKNQLEYKPVALLFHKMVFETLPMFSGGTCRDSTVKNRSEPTPQGFKKGNWHWDPQFVV
YQLKVKIHTSNPAHTRREDKHMYFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPDEEKKREENGTVVSDMDCQQQQPPPGPPSNAERRDSTRDGDKERVWDRDKDKDR
DKEREKERDRDRDYLILTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPTNSEAST
STSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEEHHTQITKV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgattataaaagaaatggtcagccgcaacaaaaggagatatcaggaggacggc
ttcgacctggacttgacatatatctatcccaacattattgcaatggggttcccagcggag
aggctcgaaggggtgtacagaaataatatagacgatgtggttaggtttctcgactcgaag
cataaaaaccattacaaaatctacaacctctgcgcagaaagacactacgatgctgccaaa
tttaactgcagagttgcacagtacccgtttgaagaccacaaccctccccagttggagcta
atcaagccgttctgtgaagatctggaccagtggctcagtgaagacgacaatcacgtggcg
gccatccactgtaaggcaggcaaaggtcgcacgggggtcatgatctgcgcctaccttctc
catcgtggcaagttcgtcgaggcccaggaagctctcgacttctacggggaagtcaggaca
agggacaagaagggagtaacaatccccagccaacggcgctacgttcactactacaactac
ctactgaagaaccagctggagtacaaaccggtggccctgctcttccacaaaatggtgttt
gagactctccccatgttcagcgggggcacctgcagggacagtaccgtaaaaaacaggagc
gagccgacccctcagggcttcaagaaagggaattggcactgggacccccagttcgtggtg
taccagctgaaggtgaagatccacacgtcaaaccctgctcacacgcggcgcgaggacaag
cacatgtactttgagttccctcagccgctgcccgtctgcggagacatcaaagtggagttc
ttccataaacagaataagatgatgaagaaggacaaaatgttccacttctgggtgaacacg
ttcttcatcccgggtccagatgaggagaagaagcgcgaggagaacgggacggtggtgagc
gacatggactgtcagcagcaacagcctccaccgggcccaccaagcaacgccgagcgcaga
gacagcaccagagacggagacaaggagcgtgtctgggacagggacaaagacaaggacagg
gacaaagagagggagaaggagcgcgacagggaccgggactacctcatcctgacgctaacc
aagaacgacctggacaaggcaaacaaggataaagctaaccgctacttctctccaaacttc
aaggtgaagttgtactttacaaaaactgtggaggagcccacgaattcggaggcgagcact
tcgacatcagtcaccccggacgttagcgacaatgagccagaccattacagatactctgac
accactgactctgatccggaaaatgaaccttttgatgaagagcaccacacacagataacc
aaagtgtga

DBGET integrated database retrieval system