KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110157633Help
Entry
110157633         CDS       T05002                                 

Definition
(RefSeq) elongation of very long chain fatty acids protein 1-like
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00062  Fatty acid elongation
bpec01040  Biosynthesis of unsaturated fatty acids
bpec01100  Metabolic pathways
bpec01212  Fatty acid metabolism
Module
bpec_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    110157633
   01040 Biosynthesis of unsaturated fatty acids
    110157633
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bpec01004]
    110157633
Enzymes [BR:bpec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     110157633
Lipid biosynthesis proteins [BR:bpec01004]
 Elongase
  PUFA
   110157633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 110157633
NCBI-ProteinID: XP_020777643
LinkDB All DBs
Position
Unknown
AA seq 314 aa AA seqDB search
MSRQIASGIVQLNDYFFEKIDVRVRDYPLMQSPIDMTVILLTYVFFSVYAGPQIMANRKP
LRLNTAMICYNLSMVLFNAYIVYEFLMSGWATTFTWRCDLIDTSNSPQSLRMVRVAWMFY
ISKYIELLDTVFFVLRKKQNQITFLHVFHHSVMPWSWWWGVTLTPAGGMGSFHAMVNSAV
HVIMYFYYGLSAAGPRFQKYLWWKKYMTAIQLTQFILVSIHISQYYFMEKCDYQFPLWIH
LIWMYGVFFFVLFSRFWVQAYIRGKRLPASESTKETNGSTQDNVKILANGNHVGNGHVHH
HTNGNIFMGKVKEI
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgacaaattgcatcagggattgtacaactcaacgattacttttttgaaaaaata
gatgtcagagttcgggactacccactaatgcagagtcctatagatatgactgttatactg
ctgacctatgtcttcttctctgtgtatgctgggccacaaatcatggccaaccgcaaacct
ctacgattaaatacagctatgatatgctacaatctatccatggttttatttaatgcttac
attgtctatgagttcttgatgtcaggatgggctacaacatttacatggagatgtgaccta
atcgacacctccaacagtccacaaagcctcaggatggttcgagtagcatggatgttttat
atttcaaaatacattgaacttctggacacagtgttctttgtactaaggaagaaacaaaac
cagattacatttcttcatgtttttcaccactctgttatgccctggagttggtggtggggt
gtcactcttacccctgctggaggaatggggtcttttcatgccatggtgaactctgctgtc
catgtcatcatgtacttttactatggactatctgctgctggcccacgctttcagaaatac
ctgtggtggaagaagtatatgactgccatccagctaactcaatttattctggtgtccatt
catatcagccagtactattttatggaaaaatgtgattatcagtttccattgtggattcac
ctcatctggatgtatggtgtcttcttctttgtcctcttctctcgtttttgggtgcaagct
tacataaggggcaagcgacttcctgcctcagagagcaccaaagagacgaatggatcaaca
caagacaatgttaaaattttggccaatggcaaccacgtgggtaatggacatgttcatcac
cataccaatggaaatatattcatgggaaaagtaaaggaaatttga

DBGET integrated database retrieval system