KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110157747Help
Entry
110157747         CDS       T05002                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00052  Galactose metabolism
bpec00500  Starch and sucrose metabolism
bpec01100  Metabolic pathways
bpec04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110157747
   00500 Starch and sucrose metabolism
    110157747
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110157747
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpec04147]
    110157747
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110157747
Exosome [BR:bpec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110157747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 110157747
NCBI-ProteinID: XP_020777774
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MVSYKRLDPEQVRFSGGAFSDERPPVYEETAVPEQEEAPLMHWTRRCSVTRSLFVIGCLL
LLLLGGWLLGTRYWLLSSPSSSLPHHPPAPAPGRGSNPNSTAPSSAPAPPREGCTVVPET
WRFDCYPERGAIVTQEICESRNCCFVPGRTGQDGVPWCFYPPDFPSYSLVSMQPTPLGQK
GVLQRQHKTYYPGDIMRLQLEVFEETNSRLHVKITDASSPRYEVPIEVPSATERAQTPEY
VLELSKEPFGVIVSRRSTGAVLVNTSVAPLLYTDQYLQMSSSLTSQYIYGLGEHRSSFQH
DLQWNTLTMWARDVPPTEKTNLYGVHPFYLGLEEGGLAHGFFLLNSNAMDVVLQPAPAIT
WRTIGGVLDFYLFLGPEPASVVQQYLEVVGRPAMPIYWALGFHLCRWGYKTSNATWEVVK
SMRDYGIPQDVQWNDIDYMERCLDFTYDPVNFNTLPELVKDLDAHDQRYVLILDPGISST
QPPGEYWPYDEGQKRAVFIRDADGNTLIGKVWPGLTAYPDFSDEATHEWWFENIQRFYRK
VPFDGLWIDMNEPSNFLDGSTNGCPSNSLENPPYTPGVLGGLLRSKTVCASAQQKLSSHY
NLHSLYGLQEARATSSALRRLLGKRPFVISRSSFPGQGQYSGHWLGDNRSNWKDMAASIA
GILSFNLLGVPLVGADVCGFSEQTDEELCVRWTQLGALYPFSRNHNAMDSPAQDPSAFSP
SARAAMRSALLLRYSLFPLLYTLFHQAHAHGHTVARPLLFEFPHDPHTYGIDQQFLWGRG
LLVTPVLLPGVDSVQGYFPAGHWYDFYTGNSFLSAGEERSLPAPLDKINLHLREGTITPT
QRPNLTLWVSSGQPLHLLCALSEEGDASGEMFWDDGESLDTYENEQYAYVLFNISKNVLR
SSVVHAHVEASYITVESSSFYGVQIRPEQVLVNGLEASFTYEDNKVLTVADLGLNLNQNF
TISWS
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcatacaagcgtctggacccagagcaggtgcgcttctctgggggggccttcagc
gatgagaggccaccggtttacgaggagactgccgtcccagagcaagaggaggcccctctg
atgcactggactcgccgctgctccgtcactagaagcctgtttgtgattggatgtctgctg
ctgctcctgttggggggctggctcctgggaaccagatactggctcctctcctccccctcc
tcctcactcccccaccatccccctgctcccgctccaggcagaggctctaaccctaactcc
acagccccctccagtgcccctgctccccccagagaaggctgcacggtggtgccagagacc
tggaggtttgactgttacccggagagaggggcaatcgtgacccaggagatttgtgagtcc
cggaactgctgctttgtccctgggcgcaccgggcaagacggggtgccctggtgcttctac
cccccagacttcccctcgtactccctggtgtccatgcagcccacccccctggggcagaag
ggcgtcctgcagaggcagcacaagacctactacccaggagacatcatgaggctgcagctg
gaggtgtttgaagagaccaactcacgcttacatgtcaagatcacggatgcttccagcccc
aggtatgaggtccccatagaggtcccctctgccacagagagggcccagactccagagtat
gtgctggagctgtccaaagagccgtttggagtcatcgtgagccgaagatccactggagcc
gttcttgtgaacaccagcgtggctcctctcctgtacacagaccagtacctgcagatgtcc
agctctctgacctctcagtacatctacggcctgggagagcaccgctcctccttccaacac
gacctccaatggaacacactgaccatgtgggcgcgcgatgtgcctcctacggagaagacc
aacttgtacggcgtgcacccgttctacctgggcctggaggagggagggctggctcatgga
ttcttcctgctcaactccaacgccatggatgtggtgctgcagcctgctcctgcaatcacc
tggaggaccatcggaggggtgctggacttttacctgttcctgggcccggagccagcctca
gtggtgcagcagtacctggaggttgttggacgcccagccatgcccatatactgggccttg
ggcttccatctctgccgctggggctacaagaccagcaacgctacctgggaggtggtcaag
agcatgagggactatggtatacctcaggacgtccagtggaatgacatagactacatggag
cgctgcctggactttacctatgacccagtgaactttaacactctacccgagctggtgaaa
gacctggacgcccatgaccagcgctacgtcctcatactggacccaggcatcagcagcacc
caacccccgggagaatactggccctacgatgaaggccaaaagagagcagtgttcatcaga
gatgcagatgggaatacactcatcgggaaggtgtggcctggtctcacagcatacccagac
ttctcagatgaggccacacatgagtggtggttcgagaacatccagcgtttctacaggaag
gtcccctttgacggcttgtggatcgacatgaatgaaccctccaacttcctggatggctct
acaaatggctgcccctccaacagcttagagaaccctccatacacaccaggtgtgctcgga
ggtctgctgcgctccaaaacagtgtgtgccagcgcccagcagaagctctcctctcactac
aacctgcacagcttgtacggcctgcaggaggccagggctacctctagcgcactgaggcgg
ctcctggggaagcgtccctttgtcatctcgcgctcatccttccctggacagggacagtac
tctggacactggctcggagacaaccgcagtaactggaaggacatggcggcctccatcgca
ggtatcctgagctttaacctgctgggcgtgcctctggtgggggcagacgtgtgcggcttc
agtgagcagacagacgaggagctgtgtgtgcgctggacccagctcggagcactgtacccc
ttcagccgcaaccacaatgccatggacagcccagctcaggacccctcagccttcagcccc
tctgctcgtgctgccatgagatcagccctgctcctgagatactccctgtttcctctgctg
tacacgctgttccaccaggctcacgcacacgggcacacagtggcccgccccctgctgttc
gagtttccccatgacccacacacctatgggatcgaccagcagtttctttgggggcggggc
ttactggtcaccccagtgctacttcctggtgtggactctgtgcaggggtacttcccagct
ggccactggtacgatttctacacggggaacagcttcctcagtgctggagaggagaggagt
ctacctgctcctctggacaagatcaacctccacctgagagagggcaccatcacccccaca
cagaggcctaacctgacactgtgggtgagcagtgggcagcccctgcacctgctctgtgct
ctgtctgaggagggagacgcctctggagagatgttttgggacgacggggagagcctggac
acatatgagaatgagcagtacgcctatgtgctcttcaacatttccaagaacgtcctgcgc
tcttcggtggtgcatgctcatgtggaggcctcttacatcacagtagaatcctcttcgttc
tatggagttcagatcagacctgagcaggtcctggtcaacggcctggaggcctccttcacc
tatgaggacaacaaggttctgactgtagcagacctgggactgaacctcaaccagaacttc
accatcagctggagctaa

DBGET integrated database retrieval system