KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110158208Help
Entry
110158208         CDS       T05002                                 

Gene name
gys1
Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00500  Starch and sucrose metabolism
bpec01100  Metabolic pathways
bpec04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110158208 (gys1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    110158208 (gys1)
Enzymes [BR:bpec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     110158208 (gys1)
Glycosyltransferases [BR:bpec01003]
 Polysaccharide
  Storage polysaccharide
   110158208 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 110158208
NCBI-ProteinID: XP_020778309
LinkDB All DBs
Position
Unknown
AA seq 805 aa AA seqDB search
MPLPRSLSVTSLPGMEDWDEDFDLEDAVLFEIAWEVANKVGGIYTVIQTKARLTAEEWGE
NYFLVGPYVESNVRTQVELIEPTNPVLKRTIDQMNASGCKLYFGRWLIEGSPYVILIDVA
YTAWSLDSWKSELWELCSIGVPWFDREANDAVLFGFLTAWFLGEYAAQSEEPPHIVAHFH
EWLAGLGLVLTRQRQLPVATIFTTHATLLGRYLCAGNVDFYNNLAQFNLDKEAGDRQIYH
RYCIERAAAHCAHVFTTVSKITAIEAEHLLKRKPDIVTPNGLNVKKFSAVHEFQNLHAMN
KNRIQEFVRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADLFLEALARLNYLLRVNNSDV
TVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDVAKML
DKEDFTIMKRAIFATQRQSQPPICTHNMLEDSSDPILNCVRRIGLFNSSSDRVKIIFHPE
FLSSTSPLLPMDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYVAARHMALAKAFPDTFIYDTQEPTSTSGFRYPRPASVPPSPALSRHSSPHHSEAE
DNEDDERYDEDLEAEKDRVNIRQPYNYPFKNKVPVAAAAAATPVTNSIADSYVSSKSDRS
SEVSSEVSSEISSESSHKGSNKSSEKGSEKGSEKGSDKGSDKGSDKGSDKESDKESDKES
DKESDKESDKGSDKESDKESEKGEN
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgccgctccctcgcagcctgtccgtcacgtccctcccggggatggaggactgggacgaa
gactttgatttggaggatgcagtgctttttgaaatcgcctgggaggttgccaacaaagtt
ggaggcatctacacggtgatccagaccaaagcgcgcctgaccgcagaggaatggggagag
aactatttcctggtggggccctacgtagagagcaatgtacgcacacaggtggagttgatc
gagcccaccaacccggtactgaagaggaccattgaccaaatgaacgccagtggatgtaag
ctctactttggtcgctggctgatagagggcagtccttatgtaattctgattgatgttgca
tacaccgcctggtctctggacagctggaagagcgagctgtgggagctttgttctatcggg
gtcccgtggtttgaccgagaggccaacgatgccgtgctttttggcttccttacagcatgg
tttcttggcgagtatgcagcccagtcagaggagccgcctcacatcgtggcccatttccat
gagtggttggcgggactggggttagtgttaactcgacagaggcagctgcccgtagcaacc
atcttcactactcacgctacactgttgggaagatacctgtgtgctggaaatgtggacttt
tataacaatctggcacagttcaatctggacaaagaggctggtgacagacagatttaccac
cggtactgcatcgagagagcggctgcacattgcgctcacgttttcaccactgtgtccaag
atcactgcgatagaggcagagcacttactcaagaggaaaccagatatcgtcactccaaat
gggctcaatgttaagaagttttccgctgtgcacgagtttcagaacttgcacgccatgaac
aagaatcgtattcaggagtttgtgagaggacacttctatgggcatcttgattttaacctg
gacaagtgcctgtttcttttcatcgctggaaggtacgagttttccaataagggagcggac
ctgtttctggaggcattggctcgactcaactacctcctcagagttaacaacagtgatgtg
accgtcatagctttcttcattatgccagctcgaacaaataactttaatgtggagacactg
aagggccaagctgtcaggaagcagctttgggacacagctcagactgtgaaagaacgcttt
gggaagaaactgtatgagtcgcttttagttgggcagcttccagatgtagccaagatgctg
gacaaagaggatttcacgatcatgaaacgcgccatctttgccacgcagcgtcagtcccag
ccccccatctgcacccacaacatgttagaggacagcagtgaccccatcctcaactgtgtg
cgtcgcatcggcctttttaacagctcctctgaccgcgtcaagataatcttccatccagag
ttcctgtcatccacttcccctctacttccaatggattatgaggattttgtgagaggctgc
cacctaggggtctttccttcttactacgagccctggggctacacaccagctgagtgcaca
gtcatgggaatcccctcagtgtccacaaacctctctgggtttggatgtttcatggaggaa
catatagcagatccctcagcctatggtatctacatcctggaccggcgcttcaggggagtg
gacgagtcgtgtaaccagctcacgtccttcctcttccagttttgtaaacagagccgacgc
cagaggatcatccagaggaaccgcactgagcgcctcagcgacctgctggactggagatac
ctggggcggtattatgtcgcagctcgtcacatggcactggccaaagccttccctgacacc
ttcatttatgacactcaggagcccacgtcgacctccggattccggtacccgcgcccggcc
tccgtgcccccctcacctgccctgtcccgccactcttccccccatcacagcgaggcggag
gacaacgaggacgacgaacgctacgacgaagacctggaagcggaaaaggatcgcgtgaac
atccgccagccgtacaactacccgttcaaaaacaaagtccctgtcgctgccgctgccgct
gccacaccggtcaccaacagcatcgcagacagttacgtgagcagtaagagtgacaggagc
agcgaagtgagcagcgaagtgagcagcgaaatcagcagtgaaagcagtcataaaggtagt
aacaaaagcagcgaaaaaggcagcgaaaaaggcagcgaaaaaggcagcgacaaagggagt
gacaaagggagtgacaaagggagcgataaggaaagtgataaggaaagtgataaggaaagc
gataaggaaagcgataaggaaagcgataaggggagcgacaaggaaagtgacaaggaaagt
gagaagggggaaaactag

DBGET integrated database retrieval system