KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110158320Help
Entry
110158320         CDS       T05002                                 

Gene name
ezh2
Definition
(RefSeq) histone-lysine N-methyltransferase EZH2
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110158320 (ezh2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bpec03036]
    110158320 (ezh2)
Enzymes [BR:bpec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110158320 (ezh2)
Chromosome and associated proteins [BR:bpec03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110158320 (ezh2)
   Polycomb group proteins
    PRC2-EZH2 complex
     110158320 (ezh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC
Motif
Other DBs
NCBI-GeneID: 110158320
NCBI-ProteinID: XP_020778438
LinkDB All DBs
Position
Unknown
AA seq 767 aa AA seqDB search
MVLTGKRSEKGPACWKRRVKSEYTRLRQLKRFRRADEVKSMFNSNRQKINERTDLLNEEW
KTRRIQPVHIMTSVSSLRGTRECTVDSGFSEFPRQVIPLKTLNAVASVPVMYSWSPLQQN
FMVEDETVLHNIPYMGDEILDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVTALA
QYSDNEEDDEEEEAEAELCDGKERPEDPRTNHEGRTNNNVSKKFPSDKIFEAISSMFPDK
GSIEELKEKYKELTEQQVPGALPPECTPNIDGPNARSVQREQSLHSFHTLFCRRCFKYDC
FLHPFHATPNTYKRKNLENLVDSKPCGIDCYMYLVQDGMVREYSSGVVGERAKTPSKRSV
GRRRGRPHSNSRPGTPTVSSETKDTDSDREGSREDEREMGGGREEERESGGTEGERETEE
DDKKDDNTSSSEGNSRCQTPVKLKLCEPESVEWSGAEASLFRVLIGTYYDNFCAIARLIG
TKTCRQVYEFRVKESSIIARAPTEDEDTPPRKKKRKHRLWATHCRKIQLKKDGSSNHVYN
YQPCDHPRQPCDSSCPCVTAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRE
CDPDLCLTCGAAEHWDSKNVSCKNCSIQRGAKKHLLLAPSDVAGWGIFIKEPVQKNEFIS
EYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKV
MMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIA
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgacggggaagcggtcggagaagggcccggcgtgttggaaacgcagagtgaag
tctgaatacaccagactgagacagttgaagcgcttcagaagagcggacgaggtcaagagc
atgttcaactcaaatcgtcagaagataaacgaacgcaccgacctcctgaacgaagagtgg
aaaacccggcgcattcagcccgttcacatcatgacctccgtgagctcgctgaggggcacc
agagagtgcacggtggacagtgggttttcggagtttccgcggcaggtgattcctctgaag
actctgaacgccgtggcctcggtcccggtcatgtactcgtggtcccccctgcagcagaac
ttcatggtggaggatgagaccgtgctccacaacatcccgtacatgggcgacgagatcctg
gaccaagatgggaccttcatcgaggagctgatcaaaaactacgatggaaaagttcatggg
gacagagagtgtggcttcataaacgatgagatctttgtggagctggtgactgcgttggct
cagtacagcgacaacgaggaagatgacgaagaggaggaggcagaggcagagctgtgtgat
gggaaagagagaccagaggaccccaggaccaaccacgaaggtcggaccaataacaatgtc
tccaagaagtttccctctgacaaaatctttgaggcgatttcctccatgtttcctgacaaa
gggtcgatcgaggagctgaaagagaagtacaaggagctgacggagcagcaggtccccggg
gcgctgcctcctgagtgcaccccaaacatcgacggaccaaacgctcgatcggtccaacgc
gagcagagcctccactccttccacacactgttctgtagacgctgcttcaaatacgactgc
ttcctccaccctttccacgcgacaccaaacacctacaaaaggaaaaatctggagaatttg
gtcgactccaaaccgtgcggcatcgactgctacatgtatctggtgcaggacgggatggtg
agagagtactcctccggagtcgtgggcgagcgcgccaagactccgtccaaacgcagcgtg
ggccgtcgccgtggtcgcccgcatagcaacagtcgccccggcacccccacggtctcctcg
gaaaccaaagacacggacagcgaccgggagggcagccgggaggacgagcgggagatgggc
ggcggccgggaggaggagagggagagcggagggacggagggagagagggagacggaagag
gacgacaagaaggacgacaacacgagcagctcagagggaaactctcggtgtcagacccct
gtgaagctgaagctgtgtgagcccgagtctgtggagtggagcggagctgaagcgtctctg
ttcagggtcctcatcgggacatactacgacaacttctgcgccatcgcccgcctcatcggg
accaaaacctgcagacaggtttacgagttcagggtgaaggagtcgagtataatcgctcga
gctccgaccgaagacgaagacacgcccccgagaaaaaagaagaggaagcaccgactctgg
gccactcactgcaggaagatccagctcaagaaagatggatcgtccaatcacgtgtacaac
taccagccgtgtgaccaccctcggcagccgtgtgactcctcctgcccctgcgtcactgcc
caaaacttctgtgaaaagttctgtcagtgcagctccgagtgtcagaaccgtttccccggc
tgccgctgtaaggctcagtgtaacacgaagcagtgtccgtgttatttggccgtgagggag
tgtgaccccgacctgtgtctcacctgtggagccgccgagcactgggacagcaagaacgtg
tcctgcaagaactgctccatacagagaggggccaagaagcacctccttctggctccctct
gacgtggccgggtggggcatcttcattaaagaaccggtccagaaaaatgagtttatttca
gagtactgtggcgagataatttctcaagacgaagccgatcgcagaggaaaggtctatgac
aaatacatgtgcagctttctcttcaatctcaacaatgattttgttgttgacgccacgagg
aaaggcaacaagatccgttttgctaatcattctgtgaacccaaactgctatgcaaaagtg
atgatggtgaacggagaccatagaataggaatcttcgccaaaagagcgattcagaccgga
gaggagctgttcttcgactacaggtacagccaggccgatgctctgaagtacgtcggtatc
gaacgtgaaatggaaatcgcctga

DBGET integrated database retrieval system