KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110158373Help
Entry
110158373         CDS       T05002                                 

Gene name
sod1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110158373 (sod1)
Enzymes [BR:bpec01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     110158373 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 110158373
NCBI-ProteinID: XP_020778489
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MALKAVCVLKGAGETSGTVYFAQEEDSATVHITGEIKGLAPGQHGFHVHAFGDNTNGCIS
AGPHFNPYNKNHAGPNDKERHIGDLGNVTAGADNIAKIDITDNVISLRGRDSIIGRTMVI
HEGVDDLGKGGNEESLKTGNAGGRLACGVIGITQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgaaagctgtttgtgtcttgaaaggagccggagagaccagtgggactgtttat
tttgcacaggaggaagattcagctactgttcacatcactggagaaatcaaaggtcttgct
cctggtcaacacggcttccatgtccatgcttttggggacaacacaaacggatgcatcagt
gctggtcctcatttcaacccctacaataagaatcatgctggccccaatgataaggaaagg
cacataggagaccttggcaatgtgaccgcaggggctgataacatcgctaagattgacatc
acggataatgtcatctctctcaggggtcgcgactcaatcattggaagaactatggtgata
catgaaggggttgacgatcttggaaaaggaggcaatgaggaaagtttaaaaactggcaac
gctggaggacgtttggcctgtggagtcattggcatcactcagtga

DBGET integrated database retrieval system