KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110159498
Entry
110159498         CDS       T05002                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04068  FoxO signaling pathway
bpec04217  Necroptosis
bpec04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110159498 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110159498 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110159498 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bpec03000]
    110159498 (stat3)
Transcription factors [BR:bpec03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    110159498 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 AAA_18 Syntaxin-6_N DUF3287
Other DBs
NCBI-GeneID: 110159498
NCBI-ProteinID: XP_020779712
LinkDB
Position
Unknown
AA seq 785 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAT
TATQDGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELAPEMNGNTQAAATRQKMAQLEQMLSALDQLRRQIVTEMGGLLTAMDYVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRSLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFADIIMGYKI
MDATNILVSPLVYLYPDIPKEEAFGKYCRPEAAPEPEMGSGDSTSIIQPYLKTKFICVTP
CPSVFMDLPDSDLLGNGFPGTNSGNTSDLFPMSPRTLDSLMHNEAEASQGHLESLTLDMD
VASPI
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggcgcagtggaatcagttgcagcagctggagactcggtacctggagcagctctatcac
ctgtacagcgacagctttcccatggagctacggcagttcctcgccccctggatcgagagc
caggactgggcttatgctgctaacaaagagtcccatgctactctggtcttccataacctc
ctgggggagatcgatcagcagtacagccgcttcctgcaggagaataacgttttgtaccag
cacaacctgaggcggatcaagcagcacctccagagcaaatacctggagaagcccatggag
atcgcccgcatcgtcgcccgctgcctgtgggaggagcaacgcctgctacagaccgccacc
accgccacacaggacggtcaggctgcacaccctacagggacagtggtcacagagaaacag
caaattttggagcacaaccttcaggacatcaggaaacgcgtgcaggatatggagcagaag
atgaaaatgctcgaaaatcttcaagacgattttgacttcaactacaagaccctcaaaagc
caaggagagttggctccggagatgaacggaaacactcaggctgctgccacccgacagaaa
atggctcaactcgaacagatgctgagcgctttggaccagctcagaagacaaatcgtgaca
gagatgggggggcttttgactgccatggattacgttcagaagaacctgacagacgaggag
ctggccgactggaagcgcagacagcagatcgcctgcatcgggggccctcccaacatctgc
ctggaccgcctcgagacctggatcacgtctttggccgagtcccagctccagatccgacag
cagattaaaaaactggaggaacttcagcagaaagtctcttataaaggagaccccataatc
cagcaccggcccgccctggaggagaagatcgtagacctgttcagaagtctcatgaagagt
gcgtttgtggtggagagacagccgtgtatgcccatgcatccagacaggcccctggtcatc
aaaacaggagtgcagttcacaaataaagtcagattactggtgaagttcccagagctcaac
taccagctgaaaattaaagtttgtattgacaaggaatcaggggatgttgctgccattcgg
ggttcacgtaaatttaacatcctcggcaccaacaccaaagtcatgaacatggaggagtcc
aacaatgggagtctgtctgcagaatttaaacacttgaccctgagggagcagaggtgtggc
aacggcggccgtaccaacagtgatgcttctttaattgtcacagaagagctgcatctcatc
acctttgaaacagaagtctatcatcagggactgaagattgatctcgagacccattcactg
ccagttgttgtcatctccaacatctgccaaatgccaaacgcctgggcctccattctgtgg
tacaacatgctcactaaccacccaaaaaatgtaaacttcttcaccaaacctccggtcggg
acttgggaccaggtggctgaggtcctgagctggcagttctcctccaccaccaaaaggggg
ctcactatcgaacagctcacgacactggcggagaaactgctgggaccttgtgtgaactac
tctggctgccaaatcacctgggccaagttctgtaaggaaaacatggctgggaagggcttt
tctttctgggtgtggttagacaacatcattgacctggttaagaaatacatcctggctttg
tggaacgaaggttatatcatgggttttatcagtaaagaacgagagagggcgatcctgagc
cccaaaccccccgggacctttttgttgagattcagtgaaagcagcaaagagggcggcatc
accttcacatgggtggagaaagacatcagcggtaagacacagatccagtcggtggagcct
tacaccaaacagcagctcaacaacatgtccttcgctgacatcatcatgggatacaagatc
atggatgccaccaacatcctggtctctccactggtctatctgtacccagacatccccaaa
gaggaggcctttggcaaatactgcagaccagaggcagcccccgagccggaaatgggatcg
ggagactccaccagcataatccagccatatttgaagaccaagttcatctgcgttaccccg
tgcccctcggtgttcatggacctaccggacagtgacctgcttgggaacggattcccaggt
acaaattcaggaaacaccagtgatctgttccccatgtctccacgcactctggactctctc
atgcacaacgaggccgaggccagtcaaggacatctggagtcgttgaccttagacatggat
gtagcgtcaccgatctga

DBGET integrated database retrieval system