KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110159726Help
Entry
110159726         CDS       T05002                                 

Definition
(RefSeq) transmembrane protease serine 9-like
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bpec01002]
    110159726
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     110159726
Peptidases [BR:bpec01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   110159726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 110159726
NCBI-ProteinID: XP_020779994
LinkDB All DBs
Position
Unknown
AA seq 1029 aa AA seqDB search
MNEFSSTNQVCGITPLNTRIVGGKDAPAGSWPWQVSLQRFGRHICGGSLINREWIMSAAH
CFSSTNTFGWEVSLGRENLQGTNPNEFSKSVSTIILHPNYDSFTSDNDIALLRLSSAVTF
TDYIRPVCLAAAHSVFNSGTDSWVTGWGTVREGVFLLSELLPFPQTLQEVEVPVVGNRQC
NCLNGVGTITDNMICAGLLDGGKDSCQGDSGGPMVSKQGSVWVQSGVVSFGFGCARPNLP
GVYSRVSNYQPWINSHISSDQPGFVQFMSSGPDPDTSATCPGLPPPPLLTTTAPPQDTTT
VPEPETTEAELLEPTAKLCGITPLNTRIVGGKDAPAGSWPWQVSLQRFGRHICGGSLINR
EWIMSAAHCFSRLSSAVTFTDYIRPVCLAAAHSVFNSGTDSWVTGWGTVREGELLPFPQT
LQEVEVPVVGNRQCNCLNGVGTITDNMICAGLLDGGKDSCQGDSGGPMVSKQGSVWVQSG
VVSFGFGCARPNLPGVYSRVSNYQPWINSHISSDQPGFVQFMSSGPDPDTSATCPGLPPP
PLLTTTAPPQDTTTVPEPETTEAELLEPTAKLCGITPLNTRIVGGKDAPAGSWPWQVSLQ
RFGRHICGGSLINREWIMSAAHCFSSTNTFGWEVSLGRENLQGTNPNEFSKSVSTIILHP
NYDSFTSDNDIALLRLSSAVTFTDYIRPVCLAAAHSVFNSGTDSWVTGWGTVREGEPLPF
PQTLQEVEVPVVGNRQCNCLNGVGTITDNMICAGLLDGGKDSCQGDSGGPMVSKQGSVWV
QSGVVSFGFGCARPNLPGVYSRVSNYQPWINSHISSDQPGFVQFMSSGPDPDTSTTCPGL
PLQMSAMSPTRSFCGVAPSDFVRNENSISQMWPWMVRIYKSGAYICGGTLIADNFVLTAA
EYFSDSNPNLQDWAVSFGQSETSSMGVVDVIMSATSGSSIALIKLAMSVSYTNDIQPVCV
DTINTTTFPVGSQCWVSAFGVMSGTSGMNGNKPTLRDLKTYVASCESVSDLGNIFSSSEV
QPHLDTPTP
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaattttctagcactaatcaagtgtgtggcatcactcctctgaacaccaggata
gttggaggcaaagatgctccagcaggaagttggccttggcaggtcagtctgcagaggttt
ggccgacacatttgtggcggatccctcatcaaccgggagtggattatgtctgctgcccat
tgtttctccagtaccaatacctttggatgggaggtttcccttggtcgagaaaacttacaa
ggcacaaacccaaatgaattttccaaatcagtgtcaacaataattttacatccaaattat
gacagttttaccagtgataacgacattgctctgctcagactgtcctcagcagtcactttc
acagattacatcaggccggtgtgtctggcagccgctcacagtgtgttcaacagtggcact
gatagctgggtcactggctggggcaccgttagagagggagtgtttctcctctcagaactg
ctcccgtttccccaaaccctacaggaagtggaagtgcctgttgtgggaaaccgtcagtgt
aactgtctgaacggcgtgggcacaatcacagacaacatgatctgcgcaggtcttttggat
ggaggaaaggactcctgtcagggagactctggaggtcccatggtcagtaagcagggctct
gtctgggttcagtctggtgtcgttagctttggttttggctgcgctcgacccaacctgcca
ggagtctactccagagtttccaactaccagccctggatcaactcccacatcagctcagat
cagcccgggtttgtccagtttatgtccagtggaccagatcctgacactagcgccacctgt
cctggtctgccccctcctcctcttctcactacaactgccccaccacaagacacaaccaca
gtcccagagccagagactacagaggcagagctgctggagcctactgcaaaactgtgtggc
atcactcctctgaacaccaggatagttggaggcaaagatgctccagcaggaagttggcct
tggcaggtcagtctgcagaggtttggccgacacatttgtggcggatccctcatcaaccgg
gagtggattatgtctgctgcccattgtttctccagactgtcctcagcagtcactttcaca
gattacatcaggccggtgtgtctggcagccgctcacagtgtgttcaacagtggcactgat
agctgggtcactggctggggcaccgttagagagggagaactgctcccgtttccccaaacc
ctacaggaagtggaagtgcctgttgtgggaaaccgtcagtgtaactgtctgaacggcgtg
ggcacaatcacagacaacatgatctgcgcaggtcttttggatggaggaaaggactcctgt
cagggagactctggaggtcccatggtcagtaagcagggctctgtctgggttcagtctggt
gtcgttagctttggttttggctgcgctcgacccaacctgccaggagtctactccagagtt
tccaactaccagccctggatcaactcccacatcagctcagatcagcccgggtttgtccag
tttatgtccagtggaccagatcctgacactagcgccacctgtcctggtctgccccctcct
cctcttctcactacaactgccccaccacaagacacaaccacagtcccagagccagagact
acagaggcagagctgctggagcctactgcaaaactgtgtggcatcactcctctgaacacc
aggatagttggaggcaaagatgctccagcaggaagttggccttggcaggtcagtctgcag
aggtttggccgacacatttgtggcggatccctcatcaaccgggagtggattatgtctgct
gcccattgtttctccagtaccaatacctttggatgggaggtttcccttggtcgagaaaac
ttacaaggcacaaacccaaatgaattttccaaatcagtgtcaacaataattttacatcca
aattatgacagttttaccagtgataacgacattgctctgctcagactgtcctcagcagtc
actttcacagattacatcaggccggtgtgtctggcagccgctcacagtgtgttcaacagt
ggcactgatagctgggtcactggctggggcaccgttagagagggagaaccgctcccgttt
ccccaaaccctacaggaagtggaagtgcctgttgtgggaaaccgtcagtgtaactgtctg
aacggcgtgggcacaatcacagacaacatgatctgcgcaggtcttttggatggaggaaag
gactcctgtcagggagactctggaggtcccatggtcagtaagcagggctctgtctgggtt
cagtctggtgtcgttagctttggttttggctgcgctcgacccaacctgccaggagtctac
tccagagtttccaactaccagccctggatcaactcccacatcagctcagatcagcccggg
tttgtccagtttatgtccagtggaccagatcctgacactagcaccacctgtcctgggctt
cctttacaaatgagtgccatgagtcctactcgctccttttgtggtgttgctcccagtgat
tttgtgagaaatgagaacagtatttctcagatgtggccatggatggtccgtatttacaaa
agcggcgcatacatttgtggaggcactctgattgctgacaactttgtccttactgctgca
gagtacttttctgactcaaatccaaatcttcaagattgggctgtgtcttttggacaaagt
gagaccagctctatgggtgttgtggatgttataatgagtgctacctcaggatccagcatt
gcactgataaagctggccatgtctgttagctacaccaatgacatccaacctgtatgtgtg
gacactatcaacaccactaccttccctgttgggagtcagtgctgggtatcagcctttgga
gttatgagtgggaccagtggtatgaatggaaacaaaccaactctcagagatctgaaaact
tatgttgcaagctgtgagagtgtttctgacctgggcaatattttctccagcagcgaagta
cagccccacctggacacgcccactccttaa

DBGET integrated database retrieval system