KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110160046Help
Entry
110160046         CDS       T05002                                 

Definition
(RefSeq) transmembrane protease serine 9-like
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bpec01002]
    110160046
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     110160046
Peptidases [BR:bpec01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   110160046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 110160046
NCBI-ProteinID: XP_020780308
LinkDB All DBs
Position
Unknown
AA seq 680 aa AA seqDB search
MEVKKDEGGPSGDSFKQGCHRTAIVASFVLFLIIGVFVGLLTTYLVQEQHSFMETVELKG
LNYDPALQNINSGFSIMLSTVLKSKIQQYSDNYVLDLLRVGLNSVMHGQPLEVPQFGQIK
AIILLGASGKSFYPIGNDINARCPDNTFTCDNGECLTKLNPECDFLPDCADESDEARCSC
GTRPAMGSRVVGGEDARHGELPWQVSLRLHGRHTCGASIVNERWLVSAAHCFERDKDPKE
WTALVGARLVSGEESESKLVNIKSLIVSPDYNPMTTDFDVTVLELETPLIFSPYIQPVCL
PSASHVFSPGQTCMVSGWGALNQFTTVPTNLQKAVVKVIDSAMCNKTSVYRGAVSHNMMC
AGFLQGKVDSCQGDSGGPLVCEGAPGRFFLAGVVSWGIGCAQINRPGVYSRVTKLRNWIL
SYTESEVPHEKPMLDTNCGMRPALGSQRIVGGVTARRGEWPWIGSLQYQRLHRCGATLIH
SKWLLTAAHCFKSDSNPNNWAVILGSVLRSGVGALVIPIQRVLIHPHFNNTNMNYDVALL
ELSMSAPMSYTIQSICLPSAVHRFMTKAECYITGWGSMREGGSLTNLLQKATVNIIDQAE
CQLSYGNVLSPNMMCAGYMEGGRDTCLGDSGGPLACREPSGQWFIAGVTSWGHGCGRIGY
PGVYTRVTSIRKWISTNVHL
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaaaaaggatgagggtggaccatctggggattcctttaagcaaggttgtcac
aggactgccattgtggccagctttgtacttttcctcattattggggtctttgtgggattg
cttacgacataccttgtgcaggaacagcacagcttcatggagacagtggagctgaagggt
ctgaactatgatccagctctgcaaaatataaactctgggttctccataatgctgtctaca
gtcctaaagtctaagattcagcagtattctgacaattatgtcctggacttgctcagagtt
gggctcaactcagtaatgcatggccagccactagaggtgccacagtttgggcagatcaaa
gctatcatcttactaggagccagtggaaaatcattttatcccattgggaatgacattaat
gccaggtgccccgataacaccttcacttgtgataatggcgaatgtttgaccaaactgaat
ccagaatgtgattttctaccagactgtgcagatgaatctgatgaagcacgctgttcatgt
gggactcgtcctgccatggggagtcgtgtagtgggtggagaagacgccagacacggagag
ctgccatggcaggtcagtctgaggctgcatggtcgacacacctgtggagcctccatcgtc
aatgaacgctggcttgtcagtgcagcacattgctttgagagggacaaagatcccaaagag
tggacagcacttgtaggggcccgtctggtgagtggtgaggagtctgagtctaaattggtc
aacatcaagtcactgatagtgtctccagattacaaccccatgaccacggactttgatgtt
actgttctggagctggaaactccccttatcttcagtccttacattcagccagtctgtctg
ccttctgcatctcatgtgttctcccctggacagacctgcatggtgtcaggatggggagca
cttaaccagtttactacggtgcccaccaatctgcagaaggcagtggtgaaggtcattgac
tctgcaatgtgtaataagacatcagtgtacagaggagcagtctctcataacatgatgtgt
gctggcttcctgcaaggcaaagtggactcctgtcagggtgattctggagggcctttagtg
tgtgaaggagccccaggcagattcttcctggctggagtggtcagctggggcataggctgt
gcacaaatcaaccgacctggagtatattcacgggtaaccaagcttcgaaactggattttg
agctacaccgaatcagaggtgccccatgaaaagccaatgttggacaccaattgcggtatg
cgtccagcattaggttctcaaaggattgtgggtggagtaacagcccgaagaggtgagtgg
ccctggattggcagcctccagtaccaaaggcttcacagatgtggtgctactcttattcac
agcaagtggctgttgacagcagcacactgtttcaaaagtgactcaaatcccaataattgg
gcagttatcctaggatctgtgctgcgctctggggtaggagcccttgtcattcccattcag
agggtccttattcatccacacttcaacaacaccaacatgaactatgatgtggctcttttg
gagctgtctatgtctgcaccaatgtcctacactatacagtccatatgcctgccctctgca
gtgcaccgcttcatgacaaaagctgagtgctacatcactggatgggggtcaatgagggag
ggaggctccctaactaacctactgcagaaggctactgtgaacatcattgaccaggcagag
tgccaactctcttatggaaatgtgctctctccaaacatgatgtgtgctgggtacatggag
gggggccgggacacttgcttgggagactcaggaggaccacttgcatgtcgtgagccttca
ggccagtggtttattgctggagtaactagttggggccatggctgtggaagaataggttat
cctggtgtatacacacgagtgacttcaattaggaagtggatctctacaaatgtgcatttg
tga

DBGET integrated database retrieval system