KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110160403
Entry
110160403         CDS       T05002                                 

Definition
(RefSeq) fibroblast growth factor 1-like isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
bpec04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110160403
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110160403
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bpec04052]
    110160403
   00536 Glycosaminoglycan binding proteins [BR:bpec00536]
    110160403
Cytokines and growth factors [BR:bpec04052]
 Growth factors
  Growth factors (RTK binding)
   110160403
Glycosaminoglycan binding proteins [BR:bpec00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110160403
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 110160403
NCBI-ProteinID: XP_020780705
LinkDB
Position
Unknown
AA seq 198 aa
MRAALSSLPCFSCLKRSQQVEEATGAENNGGIKPVVLPSDTQDSPGMYEVGDVTVLPPTP
SASPQDRPTHENRTLTRLYCKNGGYHLRITPEGRVSGGRQDNDPYDVLRLRAVSVGVVVI
KGEHSGRYLAMDTEGRLYGAVSLNDECHFIETYEENHYNTYRSQKLGWYVGLKKNGQPKP
GQDTHLGQKAVFFLPRPV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgagggcagcgctgtcttctctgccctgcttttcctgtctcaaacgctcccaacaagtg
gaagaagcaactggagcagaaaataatggagggattaaacctgttgttcttccctccgat
acacaggattctcccgggatgtacgaggtgggggacgtgaccgtgctgccccccaccccc
tcagcctctcctcaggacagacccacacacgagaacaggactctgaccagactctactgc
aagaacggaggataccacctgagaatcactccagagggcagagtgagcgggggcaggcag
gacaatgacccctatgatgtgctgaggctgagagctgtgagtgtgggggtggtggtgata
aagggggagcacagtggacggtacctggccatggacacagagggacgcctgtacggagct
gtatctctaaacgacgaatgccacttcattgagacgtacgaggagaatcattacaacacg
taccgctcgcagaagctgggatggtacgtgggactcaagaagaacggccagcccaaaccg
ggacaggacactcatctggggcagaaggccgtgttcttcttgcccaggcctgtctga

DBGET integrated database retrieval system