KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110160594Help
Entry
110160594         CDS       T05002                                 

Gene name
setd1b
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110160594 (setd1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bpec03036]
    110160594 (setd1b)
Enzymes [BR:bpec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110160594 (setd1b)
Chromosome and associated proteins [BR:bpec03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110160594 (setd1b)
   HMT complexes
    COMPASS/SET1 complex
     110160594 (setd1b)
    COMPASS/SET1 complex (yeast)
     110160594 (setd1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 110160594
NCBI-ProteinID: XP_020780928
LinkDB All DBs
Position
Unknown
AA seq 1783 aa AA seqDB search
MSKPGERNRLNEDHGRKQSSSLANGMDSHSGSTEKRSHHWRSYKLIIDPALKKGSHKLYR
YDGQTFSMPNPGLPPVDTVRDPRIGRLWTKYKETDLPVPKFKIDDCYIGRVPPKEVTFAR
LNDNIREGFLTDMCKKFGEIEEVEILYNPKNKKHLGIAKVVFESVKAAKVAVQSLHNTSV
MGNIIHVELDPKGENRLRYFQLLMNGSYTPRTLPVGGEEAKVSPRTLAEAILACEPIRRL
SESNATGGAVPPSNSTTPLSSEAGYSSLRQDTPQSQGTPHTPRQTSTPFSQDSNYSSRQS
TPAYQPNRAESSAGYKSRRHESKFQDAYNRRPERPQYRSNMYRSSSSEQAPYKQQQVTPP
EPPPSTPSYSYTTPTPPTPSFKSAFSPYQTPLPPAFPPSEPFHHPVQRETEYLRPPQPPP
EAPSDFVTVKDRPETPPIPEPPPEPVAQPTTPPPQTPERCPSPGSPNMDSERNSLDSRIE
MLLKEKRTKLPFLAERDSDTEVRMEGSPISSSSSQLSPIPPFTGSSQGGQQNSRPCSTGL
EDISPTPLPDSDDDEPIPSTASLLRRISSPIRDKRSKSDYKDGHYRGHTPTDKMDMSHHS
SGEDMEISDDEMPNTPITSGDCGKGIVVNSAMSPMQTLALHPPGFPPLHQTGYPIPHHHY
GPHSGVPGHPHLTDPHGVPHHMLPHMGPYPHGMVPLMQMELMNCLRWEQWSTVPMSFQMQ
QQVLSRMAQTRGPYSYPHYMDSSFGGPYPPLSMSASPMSGAGTHGQPWQHASVPKFNPTV
PPPGYDSQKDDPHKATVDGVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDEWWDKKERSA
KASLTPVKGAEGKEEETKPKPKETMGSSLLENWNKGEALGYEGMGLSIGLRGAIRLPSFK
VKRKGPPDAAAASESKRARPSTPVDDELEDESKPTDESKMDGDSTAAKRRHSRPLELDSE
GEEADTSEKEESLSDREEEPEETEAKQASSNKESEDESDEEQERESSTEGTSSDSSDEEE
GQSVMSKASSDSGSDSSDSSEYEVSSEEEESEEEEDKGSEVEDGSRKTSSSSSSSSTSSD
DESETKEAASSPLGHLSEDRQDHKSKEEVTAKTRCRPPSPMEEPEEKVRPPSPAPENERD
ISGDITTLKSGSRELQANLRPPTPTGIVEDSDQKSKPKGKAEPEEVACTDAQLTSVESNS
SAPKPLASLMHLPLPPHPSLEGRSLLHPPPASLPDLPQRPRLPTDEDTPRTPGRDLLERA
RSLGKSQSTDTVPITPGGDAPLTGSGLLLSSPHIPGSPFSYPAQSPVLSAGVPRTPGRDL
TFTPVFPDPTALSLNRKTSSASIDDGPVFKEPPVSALPNQTSSVCEDLSASLSLDVPIPS
DSASSKKKAARVKARKTPMASEAEESLKVIPESVLQETYLSSKSPERTTLDFREDEVEPQ
MVIPPEDGFVSYDDEERIVKPTRRARRGWEELLLGSLSPVTTPPRTFFKPRSDFEEMTIL
YDIWNEGIDEEDVRLLKITYEKMLQQDNGNDWLNDTLWVNHPTTNIPGVKKKRRDDGMRD
HMTGCARSEGYYKIDKKDKIKYLQSTRLQSEEVPVDTQGMSIPAQVHASTRAGSERRSEQ
RRLLSSFACDSDLLKFNQLKFRKKKIRFCKSHIHDWGLFALEPIAADEMVIEYVGQNIRQ
VIADMREKRYEEEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQK
KIVIYSRQPINVNEEITYDYKFPIEDEKIPCLCGAENCRGTLN
NT seq 5352 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccaggggagagaaacagattgaacgaagaccatggcagaaaacagagttca
agtttggcgaacggcatggacagtcattctggctcgacagagaagcggagtcaccactgg
agaagttacaagttgattattgacccagctctgaagaaaggctcccacaaactgtatcgc
tatgatgggcagactttcagcatgcccaaccccggattacctcctgtggataccgttcga
gatccaaggataggtcgcctatggacaaagtacaaagagaccgacttacctgtacccaag
tttaagatcgatgactgctacattgggcgggtacctccaaaggaggtaacatttgctcga
ctgaatgataacataagggaaggatttctgacagacatgtgcaaaaaatttggggaaatt
gaggaggttgagattctttataatcctaaaaacaagaagcacttgggaattgccaaagtt
gtttttgaatccgttaaagcagccaaagtggccgtgcagtcgctgcacaacacctctgtg
atgggaaacatcatccacgtggagctggatcctaaaggtgagaatcgcctcagatacttt
caacttctgatgaatggcagctacacgccacggaccctacctgttggtggtgaggaggct
aaagtctcccctcgaacccttgcagaagccattttggcttgtgagcccattcggaggttg
tctgaaagcaacgctactggaggagcagtaccacccagcaactccacaactcctctgtca
tcagaggcgggatactccagcctaaggcaggacacaccacagtcccagggaacacctcac
acccctcgccagaccagtacacccttttctcaagactccaactactcctctcgacagtcc
acacctgcatatcaacccaaccgggctgagagctcagcaggctacaaatcccgcagacac
gagagcaagtttcaggatgcctacaatcgtcgtccagagagacctcagtatcgaagcaac
atgtaccggagttcatcatcagaacaagccccttacaagcagcagcaggtcactccacct
gagcccccaccatcaaccccatcatacagctatacaactcctaccccacctacacccagc
ttcaagtcagccttttccccctaccagacccctctgcccccggctttccctccttctgag
cctttccatcacccagtccagagagagactgagtatcttagaccacctcagccacctccg
gaagctccttccgactttgtgacagtcaaagatcggccagaaactccccctatacctgag
cccccacctgaacctgttgcacaaccaactaccccacctccccaaaccccagaacgctgc
ccctctcctggctccccaaacatggattctgaacgaaatagtctggattccaggattgag
atgcttctaaaggaaaaaaggacaaaactgccgttcctagcagaacgagactctgacaca
gaggttcggatggaaggaagtcccatttcatcgtcatcctctcagctatcccctattccc
cccttcacaggcagctctcagggtggccaacagaactctcggccttgtagcaccggtttg
gaggacatcagtccaactccactgccggactctgatgatgatgagcccatcccttcaact
gcatccctcctgaggagaatcagctcacccatacgggacaagaggagcaaaagtgactac
aaagatggacattatcgaggccacactcctacagataaaatggacatgagccatcattcg
tcgggagaagatatggaaatctctgacgatgagatgcccaatacacccatcaccagtggg
gactgtggcaaaggcattgtggtgaactctgctatgtcgccaatgcagacactggccctg
catcctcccggcttccctcctctgcaccagacaggctaccccatcccacaccaccactac
ggaccacattctggtgtccctggacacccacatctgactgaccctcatggagttccccac
catatgctgcctcacatgggtccttacccccacggcatggttcctctcatgcagatggag
ctcatgaactgtttaagatgggagcaatggagcactgtccccatgtcttttcagatgcag
cagcaggttctgagtcgcatggctcaaacaagagggccatattcctacccacactacatg
gacagctcctttggaggtccatacccccctttgtccatgagtgcatccccaatgagtgga
gcaggcacacatgggcaaccatggcagcatgctagcgtaccaaagtttaatccaacagtt
cctcctcctggatatgattcccaaaaggatgatcctcacaaagctactgtggatggagtg
ttgctagtcatagtcaaagaacttaaggccatcatgaaaagggaccttaatcgcaaaatg
gtagaggtggtggccttcagagcttttgacgaatggtgggataagaaggagcgctcagct
aaggcatcgttgacaccagtgaaaggagcagaaggtaaagaagaagaaaccaagcctaaa
cctaaagagacaatgggttccagtctgttggaaaactggaacaagggtgaagctttaggt
tacgaagggatgggcctgagcattggtctgcgaggagctatccgtttgccatccttcaag
gtgaaaagaaaaggtcctcctgacgctgctgcagcaagtgaaagcaaacgcgcacgaccc
tccactccagtggacgatgagcttgaggatgaaagtaaacccactgatgagtctaaaatg
gatggggacagcacagcagcaaagcgacggcattctcgacctcttgaactggacagtgaa
ggagaggaggcagacacctcggagaaggaggagtctctgtctgatcgggaggaggagcca
gaagaaactgaggccaagcaggcctcttcaaataaagagagtgaagatgagagtgatgaa
gagcaggagcgagagtcatcaactgagggcacatcctcagattcatctgatgaagaagag
gggcaatccgtcatgtctaaagccagctcagactctgggtcagacagctctgactcttct
gaatatgaggtgagctctgaggaagaagaaagtgaggaggaagaggataaaggaagtgag
gtcgaggacggcagtagaaagacttcttcatcctcctcttcatcgtcaacctcttctgat
gatgagagcgagacaaaagaggcagcaagctctcctttgggacatctctcagaggacagg
caagaccacaaaagtaaagaggaggtcacagccaagaccagatgcagaccacccagtccc
atggaagagccagaggagaaagtcagacctccatcacctgccccagaaaacgagcgagac
ataagtggtgacattacaactttgaagtctgggtctcgggaacttcaagcaaaccttcgg
cctcccactccgactggcatcgtggaggacagtgaccaaaagtcaaaacccaaaggtaaa
gctgaaccagaggaagtggcctgcactgatgctcaactaacatctgtagagtcaaactcc
tctgccccgaaacccctagcatctttaatgcacctccctcttcctcctcacccctctctg
gaggggcgctccctccttcacccgccccctgcttcactgccggacctcccccagcggcct
cggctccctacagacgaggatactccgcgtacaccaggcagggacctgttggagcgagct
cggagtctgggcaagtcccagagcaccgacacggtgcccatcacgcctggaggtgacgct
ccgctgaccggcagcggtctgctgcttagctcccctcatattcctggtagtcctttctcc
taccctgctcagtctcctgttcttagtgctggtgtaccccgaacaccaggaagagattta
accttcacccctgtgttccctgaccccacagcactaagcctcaacaggaaaacatcctct
gccagcattgatgatggtcctgtgttcaaagagccgcctgtcagtgctctgccaaatcag
acctcctctgtttgtgaggatctctctgcatctctgtcactggatgttcctattccatct
gactctgcatcatccaagaagaaggctgcaagagtcaaagccaggaagaccccaatggcc
tctgaagcagaagagtctcttaaggtcatcccagagtctgtccttcaggagacatatctg
tccagtaagtcccctgaacgcaccactctggactttagggaagacgaggtggaacctcaa
atggtcatacctcctgaagatggatttgtgtcgtatgatgatgaggagcgcatagtgaag
cccactcgaagggcgcgcaggggctgggaggagctgctgctgggcagcctgtctcctgtc
acaacaccccctcgcacgttcttcaaaccccggtcagatttcgaggagatgaccatcctg
tatgacatctggaatgaaggaattgatgaagaggatgtgcgacttttgaagatcacctat
gagaagatgctgcaacaggacaacggcaacgactggctgaatgacaccctgtgggtcaac
catcctactactaacatccctggagtgaagaaaaagcgcagagatgatggtatgagggat
cacatgactggctgtgcacgaagtgaaggatactataaaatcgacaaaaaagacaagatc
aaataccttcaaagtacacgtcttcagtcagaggaggttccagttgatacacaggggatg
agtattcctgctcaggtccatgcctctaccagagcgggctcggagcggcgatcagagcag
cggcgtttgttgtcctcttttgcctgcgacagtgacttactcaagttcaaccagctcaag
ttccgtaagaaaaagattcgattttgtaagtcgcacatccatgactggggtctgttcgct
ttggagcctattgctgctgatgaaatggttatcgaatatgttggacaaaatatccgacag
gtcattgctgatatgcgagagaagcgctatgaagaggagggaattggtagcagctatatg
tttcgtgttgatcatgatacaattatagatgcaaccaagtgtggcaactttgcccgcttt
atcaaccacagctgtaatccgaactgttatgcgaaggtcatcacagtggagtctcaaaag
aagattgtgatttactccagacagccaattaacgtcaatgaggagatcacatacgactac
aagttccccattgaggatgaaaagattccctgtttgtgcggtgcggagaactgtcgggga
acactgaattaa

DBGET integrated database retrieval system