KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110161311Help
Entry
110161311         CDS       T05002                                 

Gene name
pycard
Definition
(RefSeq) apoptosis-associated speck-like protein containing a CARD
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04217  Necroptosis
bpec04621  NOD-like receptor signaling pathway
bpec04623  Cytosolic DNA-sensing pathway
bpec04625  C-type lectin receptor signaling pathway
bpec05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110161311 (pycard)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110161311 (pycard)
   04623 Cytosolic DNA-sensing pathway
    110161311 (pycard)
   04625 C-type lectin receptor signaling pathway
    110161311 (pycard)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110161311 (pycard)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PYRIN CARD
Motif
Other DBs
NCBI-GeneID: 110161311
NCBI-ProteinID: XP_020781703
LinkDB All DBs
Position
Unknown
AA seq 201 aa AA seqDB search
MTTKTVIAGALEDLSQDDLAKFRLWLRERKSDGPRVRRAQVDGKNPLQLADLLVETFCEN
RAVQVTVELLRAIGCTRVAEELAEEANKLLQPAQTRQNPPAPAPGASAAPARDEHFVDRH
RIQLTERVSNINPVLDLLLQERVLTPEQYTEIRSIRTRQEQMRFLYQGPLTSGGERSKDV
FLSALRAHEIYLIKDLEEREG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacgactaaaactgtcatcgctggtgcgctcgaagacctgagtcaggatgacctcgcc
aaattccgtctgtggctgcgggagaggaagagcgacggaccgcgcgtcagacgagcccag
gtggacgggaagaaccccctgcagttggcagacctcctggtggagacgttctgtgagaac
agggccgtgcaggtgacggtggagctgctccgggccatcggctgtaccagggtagcagag
gaactggctgaagaggcaaacaaactgctgcaacctgcacagacgaggcaaaaccctcca
gctccggcccctggagcgtctgctgcacctgccagagatgaacactttgtggacagacat
cgcattcagctgaccgagcgagtgagcaacatcaaccctgttctggacctgctcctacaa
gagagagtcctgacccctgagcagtacaccgagatcagaagcatcagaaccagacaggag
cagatgaggtttttgtaccaaggacctctgacatctggaggagaacgcagcaaagacgtg
ttcctgtctgcactcagggcgcatgaaatatatctgatcaaggatctggaggagagagag
ggctag

DBGET integrated database retrieval system