KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110162114
Entry
110162114         CDS       T05002                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
bpec04210  Apoptosis
bpec04620  Toll-like receptor signaling pathway
bpec04621  NOD-like receptor signaling pathway
bpec04622  RIG-I-like receptor signaling pathway
bpec04623  Cytosolic DNA-sensing pathway
bpec04625  C-type lectin receptor signaling pathway
bpec04920  Adipocytokine signaling pathway
bpec05132  Salmonella infection
bpec05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110162114 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110162114 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110162114 (ikbkg)
   04621 NOD-like receptor signaling pathway
    110162114 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    110162114 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    110162114 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    110162114 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110162114 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110162114 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110162114 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpec01001]
    110162114 (ikbkg)
Protein kinases [BR:bpec01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   110162114 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10
Other DBs
NCBI-GeneID: 110162114
NCBI-ProteinID: XP_020782632
LinkDB
Position
Unknown
AA seq 566 aa
MVQPQPDGPMQWDMSAEDSGLRVPPELAANEVVTRLLCDNQQLREALRRSNLALRQRCEE
MEGWQRKTKEEREFLSCRFQEARALVERLAQENHSLQSLMNTPSPGSSHCCSSSHCCSSS
QTEEQRARNGPMEPPQTLDSRERKRVEETDRHTQTTPPRSLPVEGTNDVLQFLKSHKEKL
EEGMRDLKRKNEELEREREEGEKEKERMRRFIDQLRGKLALAQQTNNVTEEPHQHRSEAQ
HSSDWYRELEEKLDYLQKSSAQRDKTEALLKQKDKDCAQLAKDCEALKAQVTSLLGELNE
RQSWLDKSEHERKVLEEKLCNKQKALQGFEQELEQQRKQHIVARDKLLLQTQNLEQALKA
ERQAVAEEKKKLTQLQHAYTCLFRDYDTKLKGGDLCARLEEAERALALKQDLIDKLKEEV
EQQKASLETIPVLTAQAEIYKADFLAEREAREKLNQKKEELQDQLNQALGEIERLKQEAT
SRARIEQMKLRHLDDFPARASHIPQAPGAFPFHTAPPPSSFRGQGVAVGDQASASEEIPD
LCCPKCKYQAPDMDTLQIHVMDCITF
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggtccagccccagcctgacgggcccatgcagtgggacatgtctgcagaggacagtgga
ctcagggttcctccggaactcgcagccaatgaagtggtgacacggctcctctgtgacaac
cagcagctcagagaggccttgcggcgcagtaacttggcccttcgtcagcgctgtgaggag
atggagggatggcagaggaagacgaaagaggagagagagtttctgagctgcaggtttcag
gaggcgcgggccctagtagagagactggctcaggagaatcattctttacagagtctcatg
aacacaccgtcccccggctccagtcactgctgcagctccagtcactgctgcagctccagt
cagacagaggagcagagagccaggaacggaccaatggagcccccacagactttggattca
cgagagaggaagagagtggaggagacagatcggcacacacaaaccacgccaccacgcagt
ctgcctgtggagggcacaaatgacgtcctccagtttttgaaaagccacaaagagaagctg
gaagaaggaatgagagatctgaagaggaagaacgaagagctggagcgtgagagggaggag
ggagagaaagagaaggagaggatgaggaggtttatcgaccagctgagaggaaaactggct
ctggcacagcaaaccaataatgtgacagaggagcctcaccagcaccgctctgaggcccag
cactcttcagactggtacagagagctggaggagaaactggattatttacagaaaagttca
gctcagagagacaaaacggaggctctgctcaaacagaaggacaaagactgtgcacagttg
gccaaagactgtgaggctctgaaggcccaggtcacgtctcttctgggggagctgaacgag
aggcagagctggctggacaagagcgaacacgagcgcaaagtcctcgaggagaagttgtgc
aataagcagaaggccctgcaggggtttgagcaggaactggagcagcagaggaaacagcat
attgtggccagggacaaactcctgcttcaaacacagaatctagagcaggctctgaaggcc
gagagacaagcagtggcagaggagaagaaaaaactgacacagctacagcacgcatacacc
tgtttgttcagagactatgatactaaactcaaggggggagacctgtgtgcgcgtttagag
gaggcggagagggctctggctctcaaacaggaccttatcgacaaactcaaggaggaggtg
gagcaacagaaggcgtcattagagactatacctgtcctcactgcacaggcagagatctat
aaagcagacttcttggctgagcgagaggcacgagagaaactgaaccagaagaaagaggag
ctgcaggatcagctgaaccaggctctgggagaaattgagcggctcaaacaagaggccaca
tcacgcgcacggatcgaacagatgaagctgagacacttggatgattttccagctcgagcg
tctcacattcctcaggctccaggtgcgtttccgttccacacagcccctcccccttcgtcg
ttccgtggtcagggcgttgccgtgggcgaccaggcgtcggcgtcagaggagatccccgac
ctctgctgccccaagtgcaagtaccaggctccagacatggacacgctgcagatacatgtc
atggactgtatcaccttttaa

DBGET integrated database retrieval system